MON1B Antibody

Images

 
Western Blot: MON1B Antibody [NBP1-92131] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: MON1B Antibody [NBP1-92131] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MON1B Antibody [NBP1-92131] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MON1B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EVGGDTAAPAPGGAEDLEDTQFPSEEAREGGGVHAVPPDPEDEGLEETGSKDKDQPPSPSPPPQSEALSSTSRL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MON1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
MON1B Protein (NBP1-92131PEP)
Publications
Read Publications using
NBP1-92131 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MON1B Antibody

  • HSRG1HSV-I stimulating-related protein
  • HSV-1 stimulation-related gene 1 protein
  • KIAA0872vacuolar fusion protein MON1 homolog B
  • MON1 homolog B (yeast)
  • SAND2SRG1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-2582
Species: Ch, Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, KD, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
211-TBB/CF
Species: Hu
Applications: BA
NBP1-87592
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP1-76573
Species: Hu, Mu
Applications: ELISA, ICC, ICC/IF, IF, WB
NBP1-83278
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-84764
Species: Hu
Applications: IHC, IHC-P
NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP1-92131
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MON1B Antibody (NBP1-92131)(2)

Reviews for MON1B Antibody (NBP1-92131) (0)

There are no reviews for MON1B Antibody (NBP1-92131). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MON1B Antibody (NBP1-92131) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MON1B Products

Bioinformatics Tool for MON1B Antibody (NBP1-92131)

Discover related pathways, diseases and genes to MON1B Antibody (NBP1-92131). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MON1B Antibody (NBP1-92131)

Discover more about diseases related to MON1B Antibody (NBP1-92131).
 

Pathways for MON1B Antibody (NBP1-92131)

View related products by pathway.

Blogs on MON1B

There are no specific blogs for MON1B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MON1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MON1B
Entrez
Uniprot