SAM68 Antibody - Azide and BSA Free

Western Blot: SAM68 Antibody [H00010657-B01P] - Analysis of KHDRBS1 expression in transfected 293T cell line by KHDRBS1 polyclonal antibody. Lane 1: KHDRBS1 transfected lysate(41.91 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: SAM68 Antibody [H00010657-B01P] - Analysis of purified antibody to KHDRBS1 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SAM68 Antibody - Azide and BSA Free Summary

• Immunogen: KHDRBS1 (AAH10132.1, 1 a.a. - 381 a.a.) full-length human protein. MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYVRNLNNVPFPST
• Specificity: KHDRBS1 - KH domain containing, RNA binding, signal transduction associated 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: KHDRBS1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SAM68 Antibody - Azide and BSA Free

• FLJ34027
• GAP-associated tyrosine phosphoprotein p62
• KH domain containing, RNA binding, signal transduction associated 1
• KH domain-containing, RNA-binding, signal transduction-associated protein 1
• KHDRBS1
• p21 Ras GTPase-activating protein-associated p62
• p62
• p68
• SAM68
• Sam68GAP-associated tyrosine phosphoprotein p62 (Sam68)
• Src-associated in mitosis 68 kDa protein

Background

Recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. Role in G2-M progression in the cell cycle. Represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. Also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export Function: Isoform 3, which is expressed in growth-arrested cells only, inhibits S phase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KHDRBS1
• Entrez:
  • 10657(Human)
• Uniprot:
  • AAH10132.1(Human)