SAA2 Antibody

Images

 
Western Blot: SAA2 Antibody [H00006289-D01P] - Analysis of SAA2 expression in transfected 293T cell line by SAA2 polyclonal antibody.Lane 1: SAA2 transfected lysate(13.50 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SAA2 Antibody Summary

Immunogen
SAA2 (NP_110381.1, 1 a.a. - 122 a.a.) full-length human protein. MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY
Specificity
SAA2,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAA2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SAA2 Antibody

  • SAA
  • SAA2
  • Serum Amyloid A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2948
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
AF3856
Species: Hu
Applications: WB, IHC
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
H00006289-D01P
Species: Hu
Applications: WB

Publications for SAA2 Antibody (H00006289-D01P) (0)

There are no publications for SAA2 Antibody (H00006289-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAA2 Antibody (H00006289-D01P) (0)

There are no reviews for SAA2 Antibody (H00006289-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SAA2 Antibody (H00006289-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SAA2 Products

Bioinformatics Tool for SAA2 Antibody (H00006289-D01P)

Discover related pathways, diseases and genes to SAA2 Antibody (H00006289-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAA2 Antibody (H00006289-D01P)

Discover more about diseases related to SAA2 Antibody (H00006289-D01P).
 

Pathways for SAA2 Antibody (H00006289-D01P)

View related products by pathway.

PTMs for SAA2 Antibody (H00006289-D01P)

Learn more about PTMs related to SAA2 Antibody (H00006289-D01P).
 

Research Areas for SAA2 Antibody (H00006289-D01P)

Find related products by research area.

Blogs on SAA2

There are no specific blogs for SAA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SAA2
Entrez
Uniprot