S100Z Antibody - BSA Free

Immunohistochemistry: S100Z Antibody [NBP2-68699] - Immunohistochemical staining of human tonsil shows strong nuclear positivity in non-germinal center cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

S100Z Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit S100Z Antibody - BSA Free (NBP2-68699) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MPTQLEMAMDTMIRIFHRYSGKARKRFKLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: S100Z
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  S100Z Recombinant Protein Antigen (NBP2-68699PEP)

Reactivity Notes

Mouse 83%, Rat 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for S100Z Antibody - BSA Free

• Gm625
• S100 calcium binding protein Z
• S100 calcium-binding protein Z
• zeta

Background

Members of the S100 protein family contain 2 calcium-binding EF-hands and exhibit cell-type specific expressionpatterns. For additional background information on S100 proteins, see MIM 114085.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: S100Z