S100A2 Antibody - BSA Free

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959] - Analysis in human esophagus and liver tissues. Corresponding S100A2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959] - Staining of human esophagus shows strong positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959] - Staining of human stomach shows low expression as expected.

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959] - Staining of human esophagus shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: S100A2 Antibody [NBP2-38959] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in a subset of cells in tubules.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

S100A2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit S100A2 Antibody - BSA Free (NBP2-38959) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: S100A2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  S100A2 Protein (NBP2-38959PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for S100A2 Antibody - BSA Free

• CAN19
• CAN19protein S100-A2
• MGC111539
• S100 calcium binding protein A2
• S100 calcium-binding protein A2Protein S-100L
• S100A2
• S100L

Background

S100 alpha 2 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may have a tumor suppressor function. Chromosomal rearrangements and altered expression of this gene have been implicated in breast cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: S100A2
• Uniprot:
  • P29034()