RXR alpha/NR2B1 Antibody (6Y10M1)

Western Blot: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667] - Western blot analysis of extracts of various cell lines, using RXR alpha/NR2B1 antibody (NBP3-15667) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.

Western Blot: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667] - Western blot analysis of extracts of various cell lines, using RXR alpha/NR2B1 antibody (NBP3-15667) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunocytochemistry/ Immunofluorescence: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Confocal imaging of HeLa cells using RXR alpha/NR2B1 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of RXR alpha/NR2B1 Rabbit mAb . DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 . The ChIP sequencing results indicate the enrichment pattern of RXR alpha/NR2B1 across chromosome 19 (upper panel) and the genomic region encompassing ECH1, a representative gene enriched in RXR alpha/NR2B1 (lower panel).

Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of RXR alpha/NR2B1 Rabbit mAb . DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 . The ChIP sequencing results indicate the enrichment pattern of RXR alpha/NR2B1 in the representative genomic region surrounding ECH1 gene.

Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Chromatin immunoprecipitation analysis of extracts from HepG2 cells, using RXR alpha/NR2B1 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IP, ChIP
• Clone: 6Y10M1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

RXR alpha/NR2B1 Antibody (6Y10M1) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RXR alpha/NR2B1 (P19793). MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNP
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: RXRA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) 5μg antibody for 10μg-15μg of Chromatin
  • Chromatin Immunoprecipitation Sequencing 1:50 - 1:100
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:1000
  • Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
  • Western Blot 1:1000 - 1:2000
• Theoretical MW: 51 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RXR alpha/NR2B1 Antibody (6Y10M1)

• FLJ00280
• FLJ00318
• FLJ16020
• MGC102720
• NR2B1
• NR2B1FLJ16733
• Nuclear receptor subfamily 2 group B member 1
• retinoic acid receptor RXR-alpha
• Retinoid X receptor alpha
• retinoid X receptor, alpha
• RXR alpha
• RXRA

Background

The steroid receptor superfamily acts through direct association with DNA sequences known as hormone response elements (HREs) and bind DNA as either homo- or heterodimers. The promiscuous mediator of heterodimerization, RXR, is the receptor for 9-cis reti

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RXRA