RUNX2/CBFA1 Antibody

Images

 
Western Blot: RUNX2/CBFA1 Antibody [NBP1-89104] - Analysis in human cell line RH-30.
Immunocytochemistry/ Immunofluorescence: RUNX2/CBFA1 Antibody [NBP1-89104] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104] - Immunohistochemical staining of human salivary gland shows moderate to strong nuclear positivity in ductal cells.
Immunocytochemistry/ Immunofluorescence: RUNX2/CBFA1 Antibody [NBP1-89104] - Staining of human cell line U-2 OS shows positivity in nuclei but not nucleoli.
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104] - Immunohistochemical staining of human tonsil shows moderate to strong nuclear positivity in a subset lymphoid cells.
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104] - Immunohistochemical staining of human liver shows no positivity as expected.
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104] - Immunohistochemical staining of human rectum shows moderate to strong nuclear positivity in lymphoid cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RUNX2/CBFA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RUNX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RUNX2/CBFA1 Protein (NBP1-89104PEP)
Publications
Read Publications using
NBP1-89104 in the following applications:

  • IHC
    2 publications
  • WB
    1 publication

Reactivity Notes

Rat (81%). Reactivity reported in scientific literature (PMID: 23519026)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RUNX2/CBFA1 Antibody

  • Acute myeloid leukemia 3 protein
  • AML3CCD
  • CBFA1
  • CBFA1MGC120022
  • Core-binding factor subunit alpha-1
  • MGC120023
  • PEA2-alpha A
  • PEBP2A
  • PEBP2A1CCD1
  • PEBP2aA1
  • PEBP2-alpha A
  • runt domain, alpha subunit 1
  • runt-related transcription factor 2
  • RUNX2
  • SL3/AKV core-binding factor alpha A subunit
  • SL3-3 enhancer factor 1 alpha A subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
355-BM/CF
Species: Hu, Mu, Rt
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-38019
Species: Hu
Applications: IHC, IHC-P
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
355-BM/CF
Species: Hu, Mu, Rt
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-35213
Species: Hu
AF3075
Species: Hu
Applications: WB, ICC

Publications for RUNX2/CBFA1 Antibody (NBP1-89104)(3)

Reviews for RUNX2/CBFA1 Antibody (NBP1-89104) (0)

There are no reviews for RUNX2/CBFA1 Antibody (NBP1-89104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX2/CBFA1 Antibody (NBP1-89104). (Showing 1 - 1 of 1 FAQs).

  1. We would like an anti-RUNX2 for IHC-P which share cross reactivity with Rat, but not with Human.
    • We don't have any data for our RUNX2 antibodies that confirms they will NOT detect the human protein. When we can confirm that an antibody will not react with a certain species, we display a (-) sign on the datasheet. Otherwise, if the species is not listed it means that it has not been tested.

Secondary Antibodies

 

Isotype Controls

Additional RUNX2/CBFA1 Products

Bioinformatics Tool for RUNX2/CBFA1 Antibody (NBP1-89104)

Discover related pathways, diseases and genes to RUNX2/CBFA1 Antibody (NBP1-89104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX2/CBFA1 Antibody (NBP1-89104)

Discover more about diseases related to RUNX2/CBFA1 Antibody (NBP1-89104).
 

Pathways for RUNX2/CBFA1 Antibody (NBP1-89104)

View related products by pathway.

PTMs for RUNX2/CBFA1 Antibody (NBP1-89104)

Learn more about PTMs related to RUNX2/CBFA1 Antibody (NBP1-89104).

Blogs on RUNX2/CBFA1

There are no specific blogs for RUNX2/CBFA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RUNX2/CBFA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RUNX2
Entrez