We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

RUNX2/CBFA1 Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104] - Staining in human tonsil and liver tissues . Corresponding RUNX2 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: RUNX2/CBFA1 Antibody [NBP1-89104] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104] - Staining of human tonsil shows moderate to strong nuclear positivity in a subset lymphoid cells.
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104] - Staining of human liver shows no positivity as expected.
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104] - Staining of human rectum shows moderate to strong nuclear positivity in lymphoid cells.
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104] - Staining of human salivary gland shows moderate to strong nuclear positivity in ductal cells.
Genetic Strategies: Knockdown Validated: RUNX2/CBFA1 Antibody [NBP1-89104] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

RUNX2/CBFA1 Antibody - BSA Free Summary

Immunogen
This RUNX2/CBFA1 Antibody was developed against Recombinant Protein corresponding to amino acids: LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RUNX2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 µg/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
56.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
RUNX2/CBFA1 Recombinant Protein Antigen (NBP1-89104PEP)
Publications
Read Publications using
NBP1-89104 in the following applications:

Reactivity Notes

Expected reactivity in Rat (81%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RUNX2/CBFA1 Antibody - BSA Free

  • Acute myeloid leukemia 3 protein
  • CBFA1
  • CBF-alpha-1
  • CCD1
  • CCDAML3
  • CLCD
  • Core-binding factor subunit alpha-1
  • core-binding factor, runt domain, alpha subunit 1
  • MGC120023
  • ML3
  • oncogene AML-3
  • OSF2
  • OSF-2
  • osteoblast-specific transcription factor 2
  • PEA2aA
  • PEA2-alpha A
  • PEBP2A
  • PEBP2aA
  • PEBP2-alpha A
  • polyomavirus enhancer-binding protein 2 alpha A subunit
  • runt domain, alpha subunit 1
  • runt related transcription factor 2
  • runt-related transcription factor 2
  • RUNX2
  • SL3/AKV core-binding factor alpha A subunit
  • SL3-3 enhancer factor 1 alpha A subunit

Background

Runt-related transcription factor 2 (RUNX2), also known as CBFA1, AML-3, PEBP-2alphaA, and OSF-2, is a transcription factor that places a critical role in osteoblast differentiation and bone development (1-3). RUNX2 is a DNA-binding protein that belongs to the RUNX family which share a common runt domain (3). RUNX2 has two main isoforms which vary based on the two promoter regions (3). The main canonical isoform (P1) has MASN/DS at its N-terminus while the other (P2) isoform includes a MRIPV pentapeptide at its N-terminus (3). The RUNX2 P1 isoform has a theoretical molecular weight of 56 kDa and is synthesized as a 521 amino acid (aa) protein containing multiple domains. Specifically, RUNX2 contains transactivation domains (AD1, 2 and 3), a glutamine/alanine (Q/A)-rich domain, a runt homology domain (RHD), a nuclear localization signal (NLS), a proline/serine/threonine (PST)-rich domain, a nuclear matrix targeting signal (NMTS), a repression domain (RD), and a VWRPY region (3). RUNX2 is a heterodimer of an alpha and beta subunit where the alpha subunit binds DNA through the runt domain and the binding affinity is increased through heterodimerization (4).

Functionally, RUNX2 promotes the expression of osteoblast-specific genes vital for the osteoblast differentiation and proliferation process including type I collagen, osteocalcin (OCN), and alkaline phosphatase (APC) (1, 3). Further evidence for the role of RUNX2 is highlighted by a study of Runx2-/-mice which completely lack osteoblasts (4). Additionally, RUNX2 is also required for chondrocyte maturation, which are the cells responsible for cartilage formation (1, 3, 5). Given the role of RUNX2 in bone and cartilage maturation and formation, it is clear that defects or mutations in RUNX2 cause various bone and bone-related diseases (3, 6, 7). For instance, cleidocranial dysplasia (CCD), which presents with delayed cranial suture closure phenotypes, hypoplastic clavicles, extra teeth, and short stature, is caused by haploinsufficiency in RUNX2 (2, 3, 6). Furthermore, metaphyseal dysplasia with maxillary hypoplasia and brachydactyly (MDMHB) is a bone dysplasia disorder with a phenotype of abnormalities in the long bones, an underdeveloped jawbone, and short fingers that is caused by a duplication in RUNX2 (6). Finally, RUNX2 has been shown to be upregulated in mouse models of the joint disorder osteoarthritis (OA) and may be a potential molecular target for disease treatment (7).

Alternative names for RUNX2 include Acute myeloid leukemia 3 protein CBFA1, CBF-alpha-1, CCD1, CCDAML3, CLCD, Core-binding factor subunit alpha-1, MGC120023, ML3, oncogene AML-3, OSF2, osteoblast-specific transcription factor 2, PEA2aA, PEA2-alpha A, PEBP2A, polyomavirus enhancer-binding protein 2 alpha A subunit, runt related transcription factor 2, SL3/AKV core-binding factor alpha A subunit, and SL3-3 enhancer factor 1 alpha A subunit.

References

1. Ferreira, L. B., Gimba, E., Vinagre, J., Sobrinho-Simoes, M., & Soares, P. (2020). Molecular Aspects of Thyroid Calcification. International journal of molecular sciences. https://doi.org/10.3390/ijms21207718

2. Kim, W. J., Shin, H. L., Kim, B. S., Kim, H. J., & Ryoo, H. M. (2020). RUNX2-modifying enzymes: therapeutic targets for bone diseases. Experimental & molecular medicine. https://doi.org/10.1038/s12276-020-0471-4

3. Vimalraj, S., Arumugam, B., Miranda, P. J., & Selvamurugan, N. (2015). Runx2: Structure, function, and phosphorylation in osteoblast differentiation. International journal of biological macromolecules. https://doi.org/10.1016/j.ijbiomac.2015.04.008

4. Uniprot (Q13950)

5. Komori T. (2017). Roles of Runx2 in Skeletal Development. Advances in experimental medicine and biology. https://doi.org/10.1007/978-981-10-3233-2_6

6. Moffatt, P., Ben Amor, M., Glorieux, F. H., Roschger, P., Klaushofer, K., Schwartzentruber, J. A., Paterson, A. D., Hu, P., Marshall, C., FORGE Canada Consortium, Fahiminiya, S., Majewski, J., Beaulieu, C. L., Boycott, K. M., & Rauch, F. (2013). Metaphyseal dysplasia with maxillary hypoplasia and brachydactyly is caused by a duplication in RUNX2. American journal of human genetics. https://doi.org/10.1016/j.ajhg.2012.12.001

7. Chen, D., Kim, D. J., Shen, J., Zou, Z., & O'Keefe, R. J. (2019). Runx2 plays a central role in Osteoarthritis development. Journal of orthopaedic translation. https://doi.org/10.1016/j.jot.2019.11.008

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
355-BM
Species: Hu, Mu, Rt
Applications: BA
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
MAB7547
Species: Hu
Applications: ICC, WB
NBP2-92749
Species: Hu, Mu
Applications: ELISA, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, RI, WB
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
DPI00
Species: Hu
Applications: ELISA
NBP3-15742
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
4014-SP
Species: Hu
Applications: BA
DY805
Species: Hu
Applications: ELISA
355-BM
Species: Hu, Mu, Rt
Applications: BA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
462-TEC
Species: Mu
Applications: BA
MAB7665
Species: Hu
Applications: IHC, WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-89104
Species: Hu, Mu
Applications: WB, ICC/IF, IHC

Publications for RUNX2/CBFA1 Antibody (NBP1-89104)(6)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 4 applications: IF, IF/IHC, IHC-Fr, WB.


Filter By Application
IF
(1)
IF/IHC
(3)
IHC-Fr
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(3)
All Species

Reviews for RUNX2/CBFA1 Antibody (NBP1-89104) (0)

There are no reviews for RUNX2/CBFA1 Antibody (NBP1-89104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX2/CBFA1 Antibody (NBP1-89104). (Showing 1 - 1 of 1 FAQs).

  1. We would like an anti-RUNX2 for IHC-P which share cross reactivity with Rat, but not with Human.
    • We don't have any data for our RUNX2 antibodies that confirms they will NOT detect the human protein. When we can confirm that an antibody will not react with a certain species, we display a (-) sign on the datasheet. Otherwise, if the species is not listed it means that it has not been tested.

Secondary Antibodies

 

Isotype Controls

Additional RUNX2/CBFA1 Products

Research Areas for RUNX2/CBFA1 Antibody (NBP1-89104)

Find related products by research area.

Blogs on RUNX2/CBFA1

There are no specific blogs for RUNX2/CBFA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RUNX2/CBFA1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol RUNX2