RUNX1/CBFA2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RUNX1/CBFA2 Antibody [NBP2-55213] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RUNX1/CBFA2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RUNX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RUNX1/CBFA2 Recombinant Protein Antigen (NBP2-55213PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RUNX1/CBFA2 Antibody - BSA Free

• Acute myeloid leukemia 1 protein
• AML1
• AML1acute myeloid leukemia 1
• AML1-EVI-1
• CBFA2
• CBFA2acute myeloid leukemia 1 protein (oncogene AML-1), core-binding factor, alphasubunit10AMLCR1
• Core-binding factor subunit alpha-2
• EVI-1
• PEBP2A2
• runt domain, alpha subunit 2
• runt-related transcription factor 1
• RUNX1
• SL3/AKV core-binding factor alpha B subunit

Background

Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RUNX1