RRM2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294] - Analysis in human lymph node and skeletal muscle tissues using NBP2-47294 antibody. Corresponding RRM2 RNA-seq data are presented ...read more
Orthogonal Strategies: Western Blot: RRM2 Antibody [NBP2-47294] - Analysis in human cell lines U-251MG and SK-MEL-30 using anti-RRM2 antibody. Corresponding RRM2 RNA-seq data are presented for the same cell ...read more
Immunocytochemistry/ Immunofluorescence: RRM2 Antibody [NBP2-47294] - Staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294] - Staining of human Pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294] - Staining of human Duodenum shows moderate cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294] - Staining of human Lymph node shows moderate cytoplasmic positivity in germinal center and non-germinal center cells.
Immunohistochemistry-Paraffin: RRM2 Antibody [NBP2-47294] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

RRM2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RRM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RRM2 Protein (NBP2-47294PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RRM2 Antibody

  • C2orf48
  • EC 1.17.4.1
  • FLJ25102
  • R2
  • ribonucleoside-diphosphate reductase subunit M2
  • ribonucleotide reductase M2 polypeptide
  • ribonucleotide reductase M2
  • Ribonucleotide reductase small chain
  • Ribonucleotide reductase small subunit
  • RR2
  • RR2M
  • RRM2

Background

Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20231
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-65315
Species: Bv, Ca, Eq, Gt, Sh
Applications: Flow, IHC, IHC-Fr, IP
NBP2-46198
Species: Hu
Applications: IHC, WB
MAB6979
Species: Hu
Applications: WB
210-TA
Species: Hu
Applications: BA
NB100-64852
Species: Ca, Hu
Applications: Flow, IHC, IHC-Fr
PP-H7223-00
Species: Hu
Applications: DirELISA, IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
D6050
Species: Hu
Applications: ELISA
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF1936
Species: Hu
Applications: IP, WB
AF1034
Species: Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-76781
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for RRM2 Antibody (NBP2-47294) (0)

There are no publications for RRM2 Antibody (NBP2-47294).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RRM2 Antibody (NBP2-47294) (0)

There are no reviews for RRM2 Antibody (NBP2-47294). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RRM2 Antibody (NBP2-47294) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RRM2 Products

Bioinformatics Tool for RRM2 Antibody (NBP2-47294)

Discover related pathways, diseases and genes to RRM2 Antibody (NBP2-47294). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RRM2 Antibody (NBP2-47294)

Discover more about diseases related to RRM2 Antibody (NBP2-47294).
 

Pathways for RRM2 Antibody (NBP2-47294)

View related products by pathway.

PTMs for RRM2 Antibody (NBP2-47294)

Learn more about PTMs related to RRM2 Antibody (NBP2-47294).
 

Research Areas for RRM2 Antibody (NBP2-47294)

Find related products by research area.

Blogs on RRM2

There are no specific blogs for RRM2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RRM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RRM2