Recombinant Human RPSA Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RPSA Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 196 - 295 of Human RPSA partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTDWS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RPSA

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPSA Protein

  • 37 kDa laminin receptor precursor
  • 37/67 kDa laminin receptor
  • 37LRPNEM/1CHD4
  • 67 kDa laminin receptor
  • 67kD, ribosomal protein SA
  • 67LR
  • Colon carcinoma laminin-binding protein
  • LAMBR37 kDa laminin receptor
  • laminin binding protein
  • laminin receptor 1 (67kD, ribosomal protein SA)
  • Laminin receptor 1
  • Laminin-binding protein precursor p40
  • LAMR 1
  • lamR
  • LAMR140S ribosomal protein SA
  • LBP
  • LBP/p40
  • LRP
  • LRP/LR
  • Multidrug resistance-associated protein MGr1-Ag
  • p40
  • ribosomal protein SA

Background

RPSA - ribosomal protein SA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP2-46466
Species: Hu
Applications: IHC
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF2428
Species: Hu
Applications: WB
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC

Publications for RPSA Partial Recombinant Protein (H00003921-Q01) (0)

There are no publications for RPSA Partial Recombinant Protein (H00003921-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPSA Partial Recombinant Protein (H00003921-Q01) (0)

There are no reviews for RPSA Partial Recombinant Protein (H00003921-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPSA Partial Recombinant Protein (H00003921-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPSA Products

Bioinformatics Tool for RPSA Partial Recombinant Protein (H00003921-Q01)

Discover related pathways, diseases and genes to RPSA Partial Recombinant Protein (H00003921-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPSA Partial Recombinant Protein (H00003921-Q01)

Discover more about diseases related to RPSA Partial Recombinant Protein (H00003921-Q01).
 

Pathways for RPSA Partial Recombinant Protein (H00003921-Q01)

View related products by pathway.

PTMs for RPSA Partial Recombinant Protein (H00003921-Q01)

Learn more about PTMs related to RPSA Partial Recombinant Protein (H00003921-Q01).
 

Research Areas for RPSA Partial Recombinant Protein (H00003921-Q01)

Find related products by research area.

Blogs on RPSA

There are no specific blogs for RPSA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RPSA Antibody
NBP1-33002

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPSA Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPSA