RPL13A Antibody - BSA Free

Western Blot: RPL13A Antibody [NBP2-88184] - Host: Rabbit. Target Name: RPL13A. Sample Tissue: Human NCI-H226 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RPL13A Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPL13A. Peptide sequence: YLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPL13A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RPL13A Antibody - BSA Free

• 60S ribosomal protein L13a
• ribosomal protein L13a
• tissue specific transplantation antigen 1,23 kDa highly basic protein
• TSTA1

Background

RPL13A, also known as 60S ribosomal protein L13a, is a 24 kDa 203 amino acid protein located in the cytoplasm. The primary role of RPL13A is to encode a ribosomal protein from the L13P family. Current research is being conducted on RPL13A in relation to Treacher Collins syndrome, gingivitisc and malaria. The gene is linked to the blood circulation, stem cell differentiation, methylation, pathogenesis and cell proliferation pathways where it interacts with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D and HIST1H4E.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPL13A