ROR gamma/RORC/NR1F3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ROR gamma/RORC/NR1F3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ROR gamma/RORC/NR1F3.

  Source: E. coli

  Amino Acid Sequence: FRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: RORC
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56610.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ROR gamma/RORC/NR1F3 Recombinant Protein Antigen

• MGC129539
• NR1F3
• Nuclear receptor ROR gamma
• Nuclear receptor ROR-gamma
• Nuclear receptor RZR gamma
• Nuclear receptor RZR-gamma
• Nuclear receptor subfamily 1 group F member 3
• RAR-Related Orphan Nuclear Receptor Variant 2
• RAR-related orphan receptor C
• RAR-related orphan receptor gamma
• retinoic acid-binding receptor gamma
• retinoid-related orphan receptor gamma
• Retinoid-related orphan receptor-gamma
• ROR gamma
• RORC
• RORG
• RORGMGC129539
• RZRG
• RZRGRZR-GAMMA
• TOR

Background

ROR gamma/RORC/NR1F3, aka RAR Orphan Receptor gamma, is a Nuclear Receptor 1 Thyroid Hormone-Like receptor containing a short A-T rich sequence follow by a single core motif half-site 5'-AGGTCA-3'. RORC is a key regulator of thymopoiesis, bone metabolism, T-cell apoptosis, and lymphoid organogenesis. NR1F3 regulates intrinsic transcriptional functions. Unlike other major nuclear receptors, RORC binds as a monomer to hormone response elements and is documented in mouse thymus, adipose, bone, skeletal muscle, liver, kidney, and human skeletal muscle. An N-terminal isoform of ROR gamma, ROR gamma T, inhibits Fas ligand expression and cytokine secretion in immature thymocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for ROR gamma/RORC/NR1F3 Recombinant Protein Antigen (NBP2-56610PEP). (Showing 1 - 2 of 2 FAQ).

1. Does ROR gamma/RORC/NR1F3 antibodies comes in lyophilized form?
   • Yes, we have 3 RORC antibodies delivere in lyophilized form: MAB61091, MAB61092, MAB6109.
2. What the theoretical molecular weight for ROR gamma/RORC/NR1F3 antibodies?
   • The TMW of ROR gamma/RORC/NR1F3 antibodies is approximately 56 - 60.

Bioinformatics

• Gene Symbol: RORC