ROR gamma/RORC/NR1F3 Recombinant Protein Antigen

Images

 
There are currently no images for ROR gamma/RORC/NR1F3 Recombinant Protein Antigen (NBP2-56610PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ROR gamma/RORC/NR1F3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ROR gamma/RORC/NR1F3.

Source: E. coli

Amino Acid Sequence: FRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RORC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56610.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ROR gamma/RORC/NR1F3 Recombinant Protein Antigen

  • MGC129539
  • NR1F3
  • Nuclear receptor ROR gamma
  • Nuclear receptor ROR-gamma
  • Nuclear receptor RZR gamma
  • Nuclear receptor RZR-gamma
  • Nuclear receptor subfamily 1 group F member 3
  • RAR-Related Orphan Nuclear Receptor Variant 2
  • RAR-related orphan receptor C
  • RAR-related orphan receptor gamma
  • retinoic acid-binding receptor gamma
  • retinoid-related orphan receptor gamma
  • Retinoid-related orphan receptor-gamma
  • ROR gamma
  • RORC
  • RORG
  • RORGMGC129539
  • RZRG
  • RZRGRZR-GAMMA
  • TOR

Background

ROR gamma/RORC/NR1F3, aka RAR Orphan Receptor gamma, is a Nuclear Receptor 1 Thyroid Hormone-Like receptor containing a short A-T rich sequence follow by a single core motif half-site 5'-AGGTCA-3'. RORC is a key regulator of thymopoiesis, bone metabolism, T-cell apoptosis, and lymphoid organogenesis. NR1F3 regulates intrinsic transcriptional functions. Unlike other major nuclear receptors, RORC binds as a monomer to hormone response elements and is documented in mouse thymus, adipose, bone, skeletal muscle, liver, kidney, and human skeletal muscle. An N-terminal isoform of ROR gamma, ROR gamma T, inhibits Fas ligand expression and cytokine secretion in immature thymocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-111
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-Fr, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
DY421
Species: Mu
Applications: ELISA
NBP1-89865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
782-IL
Species: Hu
Applications: BA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NB100-1595
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-22356
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-24837
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-1049
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
NBP2-46234
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC,  IHC-P, WB
NB200-157
Species: Hu
Applications: IHC,  IHC-P, KO, WB

Publications for ROR gamma/RORC/NR1F3 Recombinant Protein Antigen (NBP2-56610PEP) (0)

There are no publications for ROR gamma/RORC/NR1F3 Recombinant Protein Antigen (NBP2-56610PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROR gamma/RORC/NR1F3 Recombinant Protein Antigen (NBP2-56610PEP) (0)

There are no reviews for ROR gamma/RORC/NR1F3 Recombinant Protein Antigen (NBP2-56610PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ROR gamma/RORC/NR1F3 Recombinant Protein Antigen (NBP2-56610PEP). (Showing 1 - 2 of 2 FAQ).

  1. Does ROR gamma/RORC/NR1F3 antibodies comes in lyophilized form?
    • Yes, we have 3 RORC antibodies delivere in lyophilized form: MAB61091, MAB61092, MAB6109.
  2. What the theoretical molecular weight for ROR gamma/RORC/NR1F3 antibodies?
    • The TMW of ROR gamma/RORC/NR1F3 antibodies is approximately 56 - 60.

Additional ROR gamma/RORC/NR1F3 Products

Research Areas for ROR gamma/RORC/NR1F3 Recombinant Protein Antigen (NBP2-56610PEP)

Find related products by research area.

Blogs on ROR gamma/RORC/NR1F3

There are no specific blogs for ROR gamma/RORC/NR1F3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ROR gamma/RORC/NR1F3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RORC