Ropporin 1-like Antibody

Images

 
Western Blot: Ropporin 1-like Antibody [NBP1-90081] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: Ropporin 1-like Antibody [NBP1-90081] - Staining of human cell line U-2 OS shows positivity in golgi apparatus.
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP1-90081] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ropporin 1-like Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ROPN1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ropporin 1-like Protein (NBP1-90081PEP)
Publications
Read Publication using NBP1-90081.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24518672)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ropporin 1-like Antibody

  • AKAP-associated sperm protein
  • ASPFLJ23003
  • FLJ25776
  • radial spoke head 11 homolog
  • rhophilin associated tail protein 1-like
  • ROPN1-like protein
  • ropporin 1-like
  • ropporin-1-like protein
  • RSPH11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-56497
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
AF5430
Species: Mu
Applications: WB, IP
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82452
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37493
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
MAB2388
Species: Hu
Applications: WB, IHC
AF4937
Species: Hu
Applications: WB, IHC

Publications for Ropporin 1-like Antibody (NBP1-90081)(1)

Reviews for Ropporin 1-like Antibody (NBP1-90081) (0)

There are no reviews for Ropporin 1-like Antibody (NBP1-90081). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ropporin 1-like Antibody (NBP1-90081) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ropporin 1-like Products

Bioinformatics Tool for Ropporin 1-like Antibody (NBP1-90081)

Discover related pathways, diseases and genes to Ropporin 1-like Antibody (NBP1-90081). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ropporin 1-like Antibody (NBP1-90081)

Discover more about diseases related to Ropporin 1-like Antibody (NBP1-90081).
 

Pathways for Ropporin 1-like Antibody (NBP1-90081)

View related products by pathway.

PTMs for Ropporin 1-like Antibody (NBP1-90081)

Learn more about PTMs related to Ropporin 1-like Antibody (NBP1-90081).

Blogs on Ropporin 1-like

There are no specific blogs for Ropporin 1-like, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ropporin 1-like Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ROPN1L