Ropporin 1-like Antibody - BSA Free

Staining of human bronchus).

Analysis in human testis and prostate tissues using NBP1-90081 antibody. Corresponding ROPN1L RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP1-90081] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP1-90081] - Staining of human prostate shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP1-90081] - Staining of human bronchus shows strong membranous positivity in respiratory epithelial cells.

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP1-90081] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.

Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP1-90081] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ropporin 1-like Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ropporin 1-like Antibody - BSA Free (NBP1-90081) is a polyclonal antibody validated for use in IHC. Anti-Ropporin 1-like Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ROPN1L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Ropporin 1-like Protein (NBP1-90081PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24518672).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ropporin 1-like Antibody - BSA Free

• AKAP-associated sperm protein
• ASPFLJ23003
• FLJ25776
• radial spoke head 11 homolog
• rhophilin associated tail protein 1-like
• ROPN1-like protein
• ropporin 1-like
• ropporin-1-like protein
• RSPH11

Background

Ropporin 1-like is encoded by this gene is a sperm protein, which interacts with A-kinase anchoring protein, AKAP3, through the amphipathic helix region of AKAP3. Type II regulatory subunit of cAMP-dependent protein kinase (PKARII) also binds to this helix domain of AKAP3, which allows PKARII to be targeted to specific subcellular compartments. It is suggested that sperm contains several proteins that bind to AKAPs in a manner similar to PKARII, and this encoded protein may be one of them. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ropporin 1-like Antibody (NBP1-90081)(1)

Publication using NBP1-90081

• Onoufriadis A, Shoemark A, Schmidts M et al. Targeted NGS gene panel identifies mutations in RSPH1 causing primary ciliary dyskinesia and a common mechanism for ciliary central pair agenesis due to radial spoke defects. Hum Mol Genet 2014-07-01 [PMID: 24518672]

Bioinformatics

• Gene Symbol: ROPN1L