Ropporin 1-like Antibody


Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP1-90081] - Analysis in human testis and prostate tissues using NBP1-90081 antibody. Corresponding ROPN1L RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP1-90081] - Staining of human bronchus shows strong membranous positivity in respiratory epithelial cells.
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP1-90081] - Staining of human bronchus, fallopian tube, liver and testis using Anti-ROPN1L antibody NBP1-90081 (A) shows similar protein distribution across more
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP1-90081] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP1-90081] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP1-90081] - Staining of human prostate shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Ropporin 1-like Antibody [NBP1-90081] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Ropporin 1-like Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDV
Specificity of human Ropporin 1-like antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04 - 0.4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ropporin 1-like Protein (NBP1-90081PEP)
Read Publication using NBP1-90081.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24518672)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Ropporin 1-like Antibody

  • AKAP-associated sperm protein
  • ASPFLJ23003
  • FLJ25776
  • radial spoke head 11 homolog
  • rhophilin associated tail protein 1-like
  • ROPN1-like protein
  • ropporin 1-like
  • ropporin-1-like protein
  • RSPH11


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Mu
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Ropporin 1-like Antibody (NBP1-90081)(1)

Reviews for Ropporin 1-like Antibody (NBP1-90081) (0)

There are no reviews for Ropporin 1-like Antibody (NBP1-90081). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ropporin 1-like Antibody (NBP1-90081) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Ropporin 1-like Products

Bioinformatics Tool for Ropporin 1-like Antibody (NBP1-90081)

Discover related pathways, diseases and genes to Ropporin 1-like Antibody (NBP1-90081). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ropporin 1-like Antibody (NBP1-90081)

Discover more about diseases related to Ropporin 1-like Antibody (NBP1-90081).

Pathways for Ropporin 1-like Antibody (NBP1-90081)

View related products by pathway.

PTMs for Ropporin 1-like Antibody (NBP1-90081)

Learn more about PTMs related to Ropporin 1-like Antibody (NBP1-90081).

Blogs on Ropporin 1-like

There are no specific blogs for Ropporin 1-like, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Ropporin 1-like Antibody and receive a gift card or discount.


Gene Symbol ROPN1L