RNF6 Antibody - BSA Free

Western Blot: RNF6 Antibody [NBP1-80251] - Titration: 1.25ug/ml Positive Control: SP2/0 cell lysate.

Immunohistochemistry-Paraffin: RNF6 Antibody [NBP1-80251] - Mouse intestine, 4-8ug/ml.

Immunohistochemistry-Paraffin: RNF6 Antibody [NBP1-80251] - Mouse Pancreas tissue, islet cell (Indicated with Arrows) 4-8ug/ml.

• Reactivity: Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

RNF6 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of mouse RNF6. Peptide sequence MDPSRSRSGGSGEESSFQENERRWQQERLHREEAYYQFINELSDEDYRLM. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF6
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 73 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for RNF6 Antibody - BSA Free

• DKFZp686P0776
• E3 ubiquitin-protein ligase RNF6
• EC 6.3.2.-
• ring finger protein (C3H2C3 type) 6
• RING-H2 protein RNF-6
• SPG2

Background

RNF6 is encoded by this gene contains a RING-H2 finger motif. Deletions and mutations in this gene were detected in esophageal squamous cell carcinoma (ESCC), suggesting that this protein may be a potential tumor suppressor. Studies of the mouse counterpart suggested a role of this protein in the transcription regulation that controls germinal differentiation. Multiple alternatively spliced transcript variants encoding the same protein are observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF6
• Uniprot:
  • NP_083050(Mouse)