GJC2 Antibody

Western Blot: GJC2 Antibody [NBP1-59263] - Antibody Titration: 1 ug/ml Human liver.

Immunohistochemistry: GJC2 Antibody [NBP1-59263] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Membrane, some cytoplasm Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec Protocol located in Reviews and Data.

Western Blot: GJC2 Antibody [NBP1-59263] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Western Blot: GJC2 Antibody [NBP1-59263] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml GJC2 is supported by BioGPS gene expression data to be expressed in HEK293T.

Western Blot: GJC2 Antibody [NBP1-59263] - Antibody Titration: 1 ug/ml Human heart.

Immunohistochemistry: GJC2 Antibody [NBP1-59263] - Human Adult heart Observed Staining: Membrane, some cytoplasm Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Concentration: 0.5 mg/ml

GJC2 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GJC2(gap junction protein, gamma 2, 47kDa) The peptide sequence was selected from the middle region of GJC2. Peptide sequence APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GJC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:100
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 47 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GJC2 Antibody

• connexin46.6
• connexin-46.6
• connexin-47
• CX46.6
• Cx47
• Gap junction alpha-12 protein
• gap junction gamma-2 protein
• gap junction protein, alpha 12, 47kDa
• gap junction protein, gamma 2, 47kDa
• GJA12connexin 47
• HLD2
• LMPH1C
• PMLDAR
• SPG44MGC105119

Background

GJC2 is a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans. Defects in this gene are the cause of autosomal recessive Pelizaeus-Merzbacher-like disease-1.This gene encodes a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans. Defects in this gene are the cause of autosomal recessive Pelizaeus-Merzbacher-like disease-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for GJC2 Antibody (NBP1-59263). (Showing 1 - 1 of 1 FAQ).

1. Has this antibody been tested for immunofluorescence in human tissue (frozen or paraffin)? If not is it possible to send a vial FOC for us to try?
   • It is company policy that we do not send out free samples. NBP2-13011 has never been tested in IHC, but NBP1-46567 has been validated for use in detecting connexin-37 in paraffin-embedded tissues and should work just fine for you. NBP1-59263 has not been tested in IHC and is our only antibody directed against connexin-47. If you would like to test this antibody in an untested application and share your results with us, then I can recommend our Innovators Reward Program. Under this program, Novus will provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal value in exchange for your new data.

Bioinformatics

• Gene Symbol: GJC2
• Uniprot:
  • Q5T442(Human)