GJC2 Antibody

Images

 
Western Blot: GJC2 Antibody [NBP1-59263] - Antibody Titration: 1 ug/ml Human liver.
Immunohistochemistry: GJC2 Antibody [NBP1-59263] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Membrane, some cytoplasm Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey ...read more
Western Blot: GJC2 Antibody [NBP1-59263] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Western Blot: GJC2 Antibody [NBP1-59263] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml GJC2 is supported by BioGPS gene expression data to be expressed in HEK293T.
Western Blot: GJC2 Antibody [NBP1-59263] - Antibody Titration: 1 ug/ml Human heart.
Immunohistochemistry: GJC2 Antibody [NBP1-59263] - Human Adult heart Observed Staining: Membrane, some cytoplasm Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GJC2 Antibody Summary

Immunogen
Synthetic peptides corresponding to GJC2(gap junction protein, gamma 2, 47kDa) The peptide sequence was selected from the middle region of GJC2. Peptide sequence APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GJC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:100
Application Notes
This is a rabbit polyclonal antibody against GJC2 and was validated on Western blot.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GJC2 Antibody

  • connexin46.6
  • connexin-46.6
  • Connexin-47
  • CX46.6
  • CX47
  • Gap junction alpha-12 protein
  • gap junction gamma-2 protein
  • gap junction protein, alpha 12, 47kDa
  • gap junction protein, gamma 2, 47kDa
  • GJA12connexin 47
  • HLD2
  • LMPH1C
  • PMLDAR
  • SPG44MGC105119

Background

GJC2 is a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans. Defects in this gene are the cause of autosomal recessive Pelizaeus-Merzbacher-like disease-1.This gene encodes a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans. Defects in this gene are the cause of autosomal recessive Pelizaeus-Merzbacher-like disease-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61141
Species: Hu
Applications: ICC/IF
NBP1-88040
Species: Hu
Applications: IHC, IHC-P
NBP2-29754
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-58660
Species: Hu
Applications: IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-59312
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
NBP1-85344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-92049
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83512
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76990
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-76331
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-38445
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GJC2 Antibody (NBP1-59263) (0)

There are no publications for GJC2 Antibody (NBP1-59263).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GJC2 Antibody (NBP1-59263) (0)

There are no reviews for GJC2 Antibody (NBP1-59263). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GJC2 Antibody (NBP1-59263). (Showing 1 - 1 of 1 FAQ).

  1. Has this antibody been tested for immunofluorescence in human tissue (frozen or paraffin)? If not is it possible to send a vial FOC for us to try?
    • It is company policy that we do not send out free samples. NBP2-13011 has never been tested in IHC, but NBP1-46567 has been validated for use in detecting connexin-37 in paraffin-embedded tissues and should work just fine for you. NBP1-59263 has not been tested in IHC and is our only antibody directed against connexin-47. If you would like to test this antibody in an untested application and share your results with us, then I can recommend our Innovators Reward Program. Under this program, Novus will provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal value in exchange for your new data.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP1-59263

Bioinformatics Tool for GJC2 Antibody (NBP1-59263)

Discover related pathways, diseases and genes to GJC2 Antibody (NBP1-59263). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GJC2 Antibody (NBP1-59263)

Discover more about diseases related to GJC2 Antibody (NBP1-59263).
 

Pathways for GJC2 Antibody (NBP1-59263)

View related products by pathway.

Blogs on GJC2

There are no specific blogs for GJC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GJC2 RNAi
H00057165-R01-20nmol

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GJC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GJC2
Uniprot