RNF5 Antibody

Western Blot: RNF5 Antibody [NBP1-79711] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Product Discontinued

RNF5 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human RNF5The immunogen for this antibody is RNF5. Peptide sequence AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 20 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RNF5 Antibody

• EC 6.3.2.-
• G16
• HsRma1
• NG2
• Protein G16
• Ram1 Homolog
• ring finger protein 5Ram1 homolog
• RING5
• RING5hsRma1
• RMA1
• RMA1E3 ubiquitin-protein ligase RNF5
• RNF5

Background

The protein encoded by the RNF5 gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF5
• Uniprot:
  • NP_008844(Human)