RNF5 Antibody

Images

 
Western Blot: RNF5 Antibody [NBP1-79711] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF5 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human RNF5The immunogen for this antibody is RNF5. Peptide sequence AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against RNF5 and was validated on Western blot.
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RNF5 Antibody

  • EC 6.3.2.-
  • G16
  • HsRma1
  • NG2
  • Protein G16
  • ring finger protein 5Ram1 homolog
  • RING5hsRma1
  • RMA1E3 ubiquitin-protein ligase RNF5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
AF2418
Species: Hu
Applications: WB, IHC, ChIP, ICC
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
AF5800
Species: Mu, Rt
Applications: WB, IHC
NBP1-22568
Species: Hu
Applications: IHC-P
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
MAB2688
Species: Hu
Applications: WB
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-79711
Species: Hu
Applications: WB

Publications for RNF5 Antibody (NBP1-79711) (0)

There are no publications for RNF5 Antibody (NBP1-79711).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF5 Antibody (NBP1-79711) (0)

There are no reviews for RNF5 Antibody (NBP1-79711). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF5 Antibody (NBP1-79711) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF5 Products

Bioinformatics Tool for RNF5 Antibody (NBP1-79711)

Discover related pathways, diseases and genes to RNF5 Antibody (NBP1-79711). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF5 Antibody (NBP1-79711)

Discover more about diseases related to RNF5 Antibody (NBP1-79711).
 

Pathways for RNF5 Antibody (NBP1-79711)

View related products by pathway.

PTMs for RNF5 Antibody (NBP1-79711)

Learn more about PTMs related to RNF5 Antibody (NBP1-79711).

Blogs on RNF5.

STING in Innate Immunity and Cancer: What’s the Buzz About?
STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF5
Uniprot