RNF34 Antibody [DyLight 650]

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 650

RNF34 Antibody [DyLight 650] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human RNF34 (NP_079402.2).
  
  Sequence:
  MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDGDQTSRSGVPAQVQSEITSAN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF34
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for RNF34 Antibody [DyLight 650]

• CARP1
• Caspase regulator CARP1
• Caspases-8 and -10-associated RING finger protein 1
• E3 ubiquitin-protein ligase RNF34
• EC 6.3.2
• EC 6.3.2.-
• FLJ21786
• FYVE-RING finger protein Momo
• hRFI
• Human RING finger homologous to inhibitor of apoptosis protein
• RFI
• RIF
• RIFF
• ring finger protein 34CARP-1
• RING finger protein RIFF

Background

The protein encoded by the RNF34 gene contains a RINF finger, a motif known to be involved in protein-protein andprotein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as amodulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alphainduced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3during the induction of apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have beenreported. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF34