RNF34 Antibody [Alexa Fluor® 532]

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Alexa Fluor 532

RNF34 Antibody [Alexa Fluor® 532] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human RNF34 (NP_079402.2).
  
  Sequence:
  MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDGDQTSRSGVPAQVQSEITSAN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF34
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for RNF34 Antibody [Alexa Fluor® 532]

• CARP1
• Caspase regulator CARP1
• Caspases-8 and -10-associated RING finger protein 1
• E3 ubiquitin-protein ligase RNF34
• EC 6.3.2
• EC 6.3.2.-
• FLJ21786
• FYVE-RING finger protein Momo
• hRFI
• Human RING finger homologous to inhibitor of apoptosis protein
• RFI
• RIF
• RIFF
• ring finger protein 34CARP-1
• RING finger protein RIFF

Background

The protein encoded by the RNF34 gene contains a RINF finger, a motif known to be involved in protein-protein andprotein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as amodulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alphainduced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3during the induction of apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have beenreported. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF34