RNF130 Antibody - BSA Free

Western Blot: RNF130 Antibody [NBP2-83454] - WB Suggested Anti-RNF130 Antibody Titration: 2.5ug/ml. Positive Control: Human Thymus

Western Blot: RNF130 Antibody [NBP2-83454] - Host: Rabbit. Target: RNF130. Positive control (+): Human Lung Tumor (T-LU). Negative control (-): Human Stomach Tumor (T-ST). Antibody concentration: 3ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

RNF130 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RNF130 Antibody - BSA Free (NBP2-83454) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human RNF130. Peptide sequence: QEPGRGAPLTFRIDRGRYGLDSPKAEVRGQVLAPLPLHGVADHLGCDPQT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF130
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for RNF130 Antibody - BSA Free

• E3 ubiquitin-protein ligase RNF130
• EC 2.1.1
• EC 6.3.2
• EC 6.3.2.-
• g1-related zinc finger protein
• G1RZFP
• Goliath homolog
• GOLIATH
• GP
• H-Goliath
• MGC117241
• MGC99542
• ring finger protein 130MGC138647

Background

RNF130 - ring finger protein 130

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF130