ATP8A2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ATP8A2 Antibody [NBP2-55197] - Staining of human cell line PC-3 shows localization to plasma membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP8A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GVTYGHFPELAREPSSDDFCRMPPPCSDSCDFDDPRLLKNIEDRHPTAPCIQEFLTLLAVCHTVVPEKDGDN
Specificity
Specificity of human ATP8A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP8A2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATP8A2 Recombinant Protein Antigen (NBP2-55197PEP)

Reactivity Notes

Mouse 88%, Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ATP8A2 Antibody

  • aminophospholipid transporter-like, class I, type 8A, member 2
  • ATPase class I type 8A member 2
  • ATPase, aminophospholipid transporter, class I, type 8A, member 2
  • DKFZp434B1913
  • probable phospholipid-transporting ATPase IB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-586
Species: Hu, Mu, Ca, Fe
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-43123
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, B/N, CyTOF-ready, Flow-CS
NBP1-84579
Species: Hu
Applications: IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
MAB5018
Species: Hu
Applications: WB, IP
NBP2-31972
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
AF4925
Species: Mu
Applications: WB, Simple Western, IHC
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for ATP8A2 Antibody (NBP2-55197) (0)

There are no publications for ATP8A2 Antibody (NBP2-55197).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP8A2 Antibody (NBP2-55197) (0)

There are no reviews for ATP8A2 Antibody (NBP2-55197). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATP8A2 Antibody (NBP2-55197) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ATP8A2 Products

Bioinformatics Tool for ATP8A2 Antibody (NBP2-55197)

Discover related pathways, diseases and genes to ATP8A2 Antibody (NBP2-55197). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP8A2 Antibody (NBP2-55197)

Discover more about diseases related to ATP8A2 Antibody (NBP2-55197).
 

Pathways for ATP8A2 Antibody (NBP2-55197)

View related products by pathway.

PTMs for ATP8A2 Antibody (NBP2-55197)

Learn more about PTMs related to ATP8A2 Antibody (NBP2-55197).

Blogs on ATP8A2

There are no specific blogs for ATP8A2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP8A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP8A2