RMND5A Antibody

Images

 
Western Blot: RMND5A Antibody [NBP2-56367] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: RMND5A Antibody [NBP2-56367] - Staining of human cell line RH-30 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RMND5A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RELEKVLHKFSGYGQLCERGLEELIDYTGGLKHEILQSHGQDAELSGTLSLVLTQCCKRIKDT
Specificity
Specificity of human RMND5A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RMND5A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RMND5A Recombinant Protein Antigen (NBP2-56367PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RMND5A Antibody

  • C-terminal to LisH motif, 44 kDa
  • CTLH
  • FLJ12753
  • FLJ13910
  • FLJ21795
  • MGC78451
  • p44CTLH
  • protein RMD5 homolog A
  • required for meiotic nuclear division 5 homolog A (S. cerevisiae)
  • RMD5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00025852-M01
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP2-15087
Species: Hu, Mu
Applications: WB
NBP1-53185
Species: Hu
Applications: WB
NBP1-80655
Species: Hu
Applications: IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
H00009146-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, RNAi, S-ELISA
NBP2-61832
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF7288
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24503
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for RMND5A Antibody (NBP2-56367) (0)

There are no publications for RMND5A Antibody (NBP2-56367).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RMND5A Antibody (NBP2-56367) (0)

There are no reviews for RMND5A Antibody (NBP2-56367). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RMND5A Antibody (NBP2-56367) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RMND5A Products

Bioinformatics Tool for RMND5A Antibody (NBP2-56367)

Discover related pathways, diseases and genes to RMND5A Antibody (NBP2-56367). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RMND5A Antibody (NBP2-56367)

Discover more about diseases related to RMND5A Antibody (NBP2-56367).

Research Areas for RMND5A Antibody (NBP2-56367)

Find related products by research area.

Blogs on RMND5A

There are no specific blogs for RMND5A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RMND5A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RMND5A