GID4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C17orf39 Antibody [NBP1-91717] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: C17orf39 Antibody [NBP1-91717] - Staining of human testis shows cytoplasmic positivity in cells of seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GID4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYE
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GID4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GID4 Recombinant Protein Antigen (NBP1-91717PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GID4 Antibody

  • C17orf39
  • chromosome 17 open reading frame 39
  • GID complex subunit 4, VID24 homolog (S. cerevisiae)
  • hypothetical protein LOC79018
  • MGC3048
  • VID24

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13234
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92337
Species: Am, Hu, Mu
Applications: IHC, IHC-P, WB
H00025852-M01
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP3-05078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-89559
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-83628
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32596
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
AF7288
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-98549
Species: Hu
Applications: WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-80456
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBL1-15012
Species: Hu
Applications: WB
NBP1-91717
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for GID4 Antibody (NBP1-91717) (0)

There are no publications for GID4 Antibody (NBP1-91717).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GID4 Antibody (NBP1-91717) (0)

There are no reviews for GID4 Antibody (NBP1-91717). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GID4 Antibody (NBP1-91717) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GID4 Products

Bioinformatics Tool for GID4 Antibody (NBP1-91717)

Discover related pathways, diseases and genes to GID4 Antibody (NBP1-91717). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GID4 Antibody (NBP1-91717)

Discover more about diseases related to GID4 Antibody (NBP1-91717).
 

Pathways for GID4 Antibody (NBP1-91717)

View related products by pathway.

PTMs for GID4 Antibody (NBP1-91717)

Learn more about PTMs related to GID4 Antibody (NBP1-91717).

Blogs on GID4

There are no specific blogs for GID4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GID4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GID4