ARMC8 Antibody (2D9)

Images

 
Western Blot: ARMC8 Antibody (2D9) [H00025852-M01] - Analysis of ARMC8 expression in transfected 293T cell line by ARMC8 monoclonal antibody (M01), clone 2D9.Lane 1: ARMC8 transfected lysate(43 KDa).Lane 2: ...read more
Immunoprecipitation: ARMC8 Antibody (2D9) [H00025852-M01] - Analysis of ARMC8 transfected lysate using anti-ARMC8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ARMC8 monoclonal antibody.
Sandwich ELISA: ARMC8 Antibody (2D9) [H00025852-M01] - Detection limit for recombinant GST tagged ARMC8 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP, S-ELISA
Clone
2D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ARMC8 Antibody (2D9) Summary

Immunogen
ARMC8 (NP_054873, 287 a.a. ~ 385 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST
Specificity
ARMC8 - armadillo repeat containing 8
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARMC8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARMC8 Antibody (2D9)

  • armadillo repeat containing 8
  • armadillo repeat-containing protein 8
  • DKFZP434A043
  • HSPC056
  • MGC10058
  • MGC4880

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92337
Species: Am, Hu, Mu
Applications: IHC, IHC-P, WB
H00009146-M01
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, KD, S-ELISA, WB
NBP1-91717
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13234
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24503
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-83628
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32596
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF7288
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-80655
Species: Hu
Applications: IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-15702
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
H00006430-B01P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-15723
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
H00025852-M01
Species: Hu
Applications: WB, ELISA, IP, S-ELISA

Publications for ARMC8 Antibody (H00025852-M01) (0)

There are no publications for ARMC8 Antibody (H00025852-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARMC8 Antibody (H00025852-M01) (0)

There are no reviews for ARMC8 Antibody (H00025852-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARMC8 Antibody (H00025852-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARMC8 Products

Bioinformatics Tool for ARMC8 Antibody (H00025852-M01)

Discover related pathways, diseases and genes to ARMC8 Antibody (H00025852-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARMC8 Antibody (H00025852-M01)

Discover more about diseases related to ARMC8 Antibody (H00025852-M01).
 

Pathways for ARMC8 Antibody (H00025852-M01)

View related products by pathway.

PTMs for ARMC8 Antibody (H00025852-M01)

Learn more about PTMs related to ARMC8 Antibody (H00025852-M01).

Blogs on ARMC8

There are no specific blogs for ARMC8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARMC8 Antibody (2D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol ARMC8
Entrez
Uniprot