ARMC8 Antibody (2D9) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse ARMC8 Antibody (2D9) - Azide and BSA Free (H00025852-M01) is a monoclonal antibody validated for use in WB, ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
ARMC8 (NP_054873, 287 a.a. ~ 385 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST |
| Specificity |
ARMC8 - armadillo repeat containing 8 |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
ARMC8 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoprecipitation
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ARMC8 Antibody (2D9) - Azide and BSA Free
Background
ARMC8 (armadillo-repeat-containing protein 8) is part of the conserved CTLH protein complex, where it is present as two alternatively spliced forms: ARMC8alpha and ARMC8beta. Studies have indicated that ARMC8alpha promotes protein degradation by both the proteasome-dependent and the vacuole/lysosome-dependent pathways, by interacting directly with the protein to be degraded or by associating with the monoubiquitin-binding protein HRS respectively. (The CTLH complex is also surmised to be involved in microtubule dynamics.)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Am, Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: WB, ELISA, IP
Publications for ARMC8 Antibody (H00025852-M01) (0)
There are no publications for ARMC8 Antibody (H00025852-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ARMC8 Antibody (H00025852-M01) (0)
There are no reviews for ARMC8 Antibody (H00025852-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ARMC8 Antibody (H00025852-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ARMC8 Products
Blogs on ARMC8