RMND5A Antibody - BSA Free

Images

 
Western Blot: RMND5A Antibody [NBP1-92337] - rmnd5 is expressed during early embryonic development. Rmnd5 protein at different developmental stages. Western blot analysis of embryo lysate from indicated stages (top). ...read more
Immunohistochemistry-Paraffin: RMND5A Antibody [NBP1-92337] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western Blot: RMND5A Antibody [NBP1-92337] - rmnd5 is expressed during early embryonic development. Temporal RT-PCR analysis of rmnd5 expression (top panel); different developmental stages (NF-stages) indicated at the ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - Rmnd5 is part of an ubiquitin ligase complex. Glycerol step gradient of Xenopus laevis NF stage 36 embryo lysates. Molecular mass (MW) standard: albumin (67 kDa), fraction 1, ...read more
RanBPM & TWA1 are essential for complex stability. Whole cell extracts prepared from control shRNA & RanBPM shRNA HEK293 cells (a), or from control (labelled as C), TWA1, RMND5A, MAEA, ARMC8 & muskelin HEK293 CRISPR ...read more
RanBPM & TWA1 are essential for complex stability. Whole cell extracts prepared from control shRNA & RanBPM shRNA HEK293 cells (a), or from control (labelled as C), TWA1, RMND5A, MAEA, ARMC8 & muskelin HEK293 CRISPR ...read more
RanBPM & TWA1 are essential for complex stability. Whole cell extracts prepared from control shRNA & RanBPM shRNA HEK293 cells (a), or from control (labelled as C), TWA1, RMND5A, MAEA, ARMC8 & muskelin HEK293 CRISPR ...read more
RanBPM & TWA1 are essential for complex stability. Whole cell extracts prepared from control shRNA & RanBPM shRNA HEK293 cells (a), or from control (labelled as C), TWA1, RMND5A, MAEA, ARMC8 & muskelin HEK293 CRISPR ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - V5-HA-tagged RanBP9 maintains its ability to interact with known members of the CTLH complex & Nucleolin. RanBP9 WT & TT immortalized Mouse Embryonic Fibroblasts (MEFs) were ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - RanBPM & TWA1 are essential for complex stability. Whole cell extracts prepared from control shRNA & RanBPM shRNA HEK293 cells (a), or from control (labelled as C), TWA1, ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - RanBPM & TWA1 are essential for complex stability. Whole cell extracts prepared from control shRNA & RanBPM shRNA HEK293 cells (a), or from control (labelled as C), TWA1, ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - The CTLH complex has E3 ligase activity. (a) RanBPM immunocomplexes have E3 ligase activity that is dependent on RMND5A. Whole cell extracts prepared from wild type (WT; ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - Characterization of the CTLH complex. (a) Schematic representation of the CTLH complex. The model is adapted from the yeast Gid complex26. Note that the position of muskelin ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - C-Raf is regulated by the proteasome through the CTLH complex. Non-targeting shRNA control & shRNA RanBPM cells were treated with 10 μM MG132 or DMSO, as vehicle, for 24 h. ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - Characterization of the CTLH complex. (a) Schematic representation of the CTLH complex. The model is adapted from the yeast Gid complex26. Note that the position of muskelin ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - The CTLH complex has E3 ligase activity. (a) RanBPM immunocomplexes have E3 ligase activity that is dependent on RMND5A. Whole cell extracts prepared from wild type (WT; ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - C-Raf is regulated by the proteasome through the CTLH complex. Non-targeting shRNA control & shRNA RanBPM cells were treated with 10 μM MG132 or DMSO, as vehicle, for 24 h. ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - Characterization of the CTLH complex. (a) Schematic representation of the CTLH complex. The model is adapted from the yeast Gid complex26. Note that the position of muskelin ...read more

Product Details

Summary
Reactivity Hu, Mu, Am, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

RMND5A Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FDSDISSVGIDGCWQADSQRLLNEVMVEHFFRQGMLDVAE
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RMND5A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RMND5A Protein (NBP1-92337PEP)
Publications
Read Publications using
NBP1-92337 in the following applications:

  • IP
    2 publications
  • WB
    5 publications

Reactivity Notes

Frog reactivity reported in scientific literature (PMID: 25793641), Mouse reactivity reported in scientific literature (bioRxiv, DOI:10.1101/745174)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RMND5A Antibody - BSA Free

  • C-terminal to LisH motif, 44 kDa
  • CTLH
  • FLJ12753
  • FLJ13910
  • FLJ21795
  • MGC78451
  • p44CTLH
  • protein RMD5 homolog A
  • required for meiotic nuclear division 5 homolog A (S. cerevisiae)
  • RMD5

Background

RMND5A, also known as Protein RMD5 homolog A, consists of a 391 amino acid long isoform that is 44 kDa and a 98 amino acid short isoform that is 11 kDa, and it is involved in protein binding and required for meiotic nuclear division. Studies of RMND5A are being done on the following diseases and disorders: lissencephaly, malaria and ductus arteriosus. This protein has been known to have interactions with SHBG, SMAD9, C20orf11, GID8, POLR3H, YPEL4, RANBP9, MKLN1, KLHL2 and CCT3 proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00025852-M01
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP1-88866
Species: Hu
Applications: IHC,  IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-15702
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-91717
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
255-SC
Species: Hu
Applications: BA
NBP3-46991
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC,  IHC-P
NBP1-83202
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF7288
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-15723
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-24503
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB

Publications for RMND5A Antibody (NBP1-92337)(6)

We have publications tested in 3 confirmed species: Human, Mouse, Frog.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(2)
WB
(5)
All Applications
Filter By Species
Human
(3)
Mouse
(2)
Frog
(1)
All Species

Reviews for RMND5A Antibody (NBP1-92337) (0)

There are no reviews for RMND5A Antibody (NBP1-92337). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RMND5A Antibody (NBP1-92337) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RMND5A Products

Research Areas for RMND5A Antibody (NBP1-92337)

Find related products by research area.

Blogs on RMND5A

There are no specific blogs for RMND5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RMND5A Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol RMND5A