Immunocytochemistry/ Immunofluorescence: RIN2 Antibody [NBP1-80854] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry: RIN2 Antibody [NBP1-80854] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Orthogonal Strategies: Western Blot: RIN2 Antibody [NBP1-80854] -Analysis in human cell line PC-3 and human cell line SK-MEL-30.
This antibody was developed against Recombinant Protein corresponding to amino acids: GEMTAWTMGARGLDKRGSFFKLIDTIASEIGELKQEMVRTDVNLENGLEPAETHSMVRHKDGGYSEEEDVKTCAR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RIN2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (83%).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for RIN2 Antibody - BSA Free
RAB5 interacting protein 2
Ras and Rab interactor 2
RAS association (RalGDS/AF-6) domain containing protein JC265
Ras association domain family 4
Ras inhibitor JC265
Ras interaction/interference protein 2
RASSF4MACS
Background
The RAB5 protein is a small GTPase involved in membrane trafficking in the early endocytic pathway. The protein encoded by this gene binds the GTP-bound form of the RAB5 protein preferentially over the GDP-bound form, and functions as a guanine nucleotide exchange factor for RAB5. The encoded protein is found primarily as a tetramer in the cytoplasm and does not bind other members of the RAB family.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our RIN2 Antibody - BSA Free and receive a gift card or discount.