RIN2 Antibody

Images

 
Western Blot: RIN2 Antibody [NBP1-80854] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-475
Immunocytochemistry/ Immunofluorescence: RIN2 Antibody [NBP1-80854] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry: RIN2 Antibody [NBP1-80854] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RIN2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GEMTAWTMGARGLDKRGSFFKLIDTIASEIGELKQEMVRTDVNLENGLEPAETHSMVRHKDGGYSEEEDVKTCAR
Specificity
Specificity of human RIN2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RIN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RIN2 Protein (NBP1-80854PEP)
Publications
Read Publications using NBP1-80854.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (83%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RIN2 Antibody

  • RAB5 interacting protein 2
  • Ras and Rab interactor 2
  • RAS association (RalGDS/AF-6) domain containing protein JC265
  • Ras association domain family 4
  • Ras inhibitor JC265
  • Ras interaction/interference protein 2
  • RASSF4MACS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-79843
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-77417
Species: Hu, Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
7270-IL/CF
Species: Hu
6507-IL/CF
Species: Hu
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB120-16518
Species: Hu, Mu, Rt, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-93743
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-80854
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RIN2 Antibody (NBP1-80854)(2)

Reviews for RIN2 Antibody (NBP1-80854) (0)

There are no reviews for RIN2 Antibody (NBP1-80854). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RIN2 Antibody (NBP1-80854) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RIN2 Products

Array NBP1-80854

Bioinformatics Tool for RIN2 Antibody (NBP1-80854)

Discover related pathways, diseases and genes to RIN2 Antibody (NBP1-80854). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIN2 Antibody (NBP1-80854)

Discover more about diseases related to RIN2 Antibody (NBP1-80854).
 

Pathways for RIN2 Antibody (NBP1-80854)

View related products by pathway.

PTMs for RIN2 Antibody (NBP1-80854)

Learn more about PTMs related to RIN2 Antibody (NBP1-80854).
 

Research Areas for RIN2 Antibody (NBP1-80854)

Find related products by research area.

Blogs on RIN2

There are no specific blogs for RIN2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RIN2
Entrez