Ribosome maturation protein SBDS Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: PTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SBDS |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Ribosome maturation protein SBDS Antibody - BSA Free
Background
The Shwachman Bodian-Diamond syndrome gene encodes a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The encoded protein may function in RNA metabolism. Mutations within this gene are associated with the autosomal recessive disorder Shwachman-Bodian-Diamond syndrome. This gene has a closely linked pseudogene that is distally located. [provided by RefSeq, Jan 2017]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: Bind
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Publications for Ribosome maturation protein SBDS Antibody (NBP1-85646) (0)
There are no publications for Ribosome maturation protein SBDS Antibody (NBP1-85646).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Ribosome maturation protein SBDS Antibody (NBP1-85646) (0)
There are no reviews for Ribosome maturation protein SBDS Antibody (NBP1-85646).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Ribosome maturation protein SBDS Antibody (NBP1-85646) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Ribosome maturation protein SBDS Products
Blogs on Ribosome maturation protein SBDS