NIP7 Antibody


Western Blot: NIP7 Antibody [NBP2-31801] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane more
Immunohistochemistry-Paraffin: NIP7 Antibody [NBP2-31801] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: NIP7 Antibody [NBP2-31801] - Staining of human lymph node shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NIP7 Antibody [NBP2-31801] - Staining in human lymph node and pancreas tissues using anti-NIP7 antibody. Corresponding NIP7 RNA-seq data are presented for the more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

NIP7 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYL
Specificity of human NIP7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NIP7 Protein (NBP2-31801PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NIP7 Antibody

  • CGI-37,60S ribosome subunit biogenesis protein NIP7 homolog
  • HSPC031
  • KD93FLJ10296
  • nuclear import 7 homolog (S. cerevisiae)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IP
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for NIP7 Antibody (NBP2-31801) (0)

There are no publications for NIP7 Antibody (NBP2-31801).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIP7 Antibody (NBP2-31801) (0)

There are no reviews for NIP7 Antibody (NBP2-31801). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NIP7 Antibody (NBP2-31801) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NIP7 Products

Bioinformatics Tool for NIP7 Antibody (NBP2-31801)

Discover related pathways, diseases and genes to NIP7 Antibody (NBP2-31801). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIP7 Antibody (NBP2-31801)

Discover more about diseases related to NIP7 Antibody (NBP2-31801).

Pathways for NIP7 Antibody (NBP2-31801)

View related products by pathway.

Research Areas for NIP7 Antibody (NBP2-31801)

Find related products by research area.

Blogs on NIP7

There are no specific blogs for NIP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NIP7 Antibody and receive a gift card or discount.


Gene Symbol NIP7