NIP7 Antibody

Images

 
Western Blot: NIP7 Antibody [NBP2-31801] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: NIP7 Antibody [NBP2-31801] - Staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NIP7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NIP7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NIP7 Protein (NBP2-31801PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NIP7 Antibody

  • CGI-37,60S ribosome subunit biogenesis protein NIP7 homolog
  • HSPC031
  • KD93FLJ10296
  • nuclear import 7 homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85646
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
NBP2-47466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-15585
Species: Hu
NBP1-92194
Species: Hu
Applications: IHC, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP1-88144
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47356
Species: Hu
Applications: IHC, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-85637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
AF1936
Species: Hu
Applications: WB, IP
NBP2-56218
Species: Hu
Applications: ICC/IF
NBP2-31801
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for NIP7 Antibody (NBP2-31801) (0)

There are no publications for NIP7 Antibody (NBP2-31801).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIP7 Antibody (NBP2-31801) (0)

There are no reviews for NIP7 Antibody (NBP2-31801). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NIP7 Antibody (NBP2-31801) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NIP7 Products

Bioinformatics Tool for NIP7 Antibody (NBP2-31801)

Discover related pathways, diseases and genes to NIP7 Antibody (NBP2-31801). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIP7 Antibody (NBP2-31801)

Discover more about diseases related to NIP7 Antibody (NBP2-31801).
 

Pathways for NIP7 Antibody (NBP2-31801)

View related products by pathway.

Research Areas for NIP7 Antibody (NBP2-31801)

Find related products by research area.

Blogs on NIP7

There are no specific blogs for NIP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NIP7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NIP7
Uniprot