RhoJ Antibody

Images

 
Western Blot: RhoJ Antibody [NBP1-89012] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: RhoJ Antibody [NBP1-89012] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RhoJ Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHOJ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RhoJ Protein (NBP1-89012PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RhoJ Antibody

  • ARHJTC10B
  • FLJ14445
  • ras homolog gene family, member J
  • RASL7B
  • Ras-like protein family member 7B
  • RAS-like, family 7, member B
  • RHOI
  • rho-related GTP-binding protein RhoJ
  • Tc10-like GTP-binding protein
  • TC10-like Rho GTPase
  • TCLMGC34777

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
H00023433-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
MAB393
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-81657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-32284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
H00051804-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NBP1-82478
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP

Publications for RhoJ Antibody (NBP1-89012) (0)

There are no publications for RhoJ Antibody (NBP1-89012).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RhoJ Antibody (NBP1-89012) (0)

There are no reviews for RhoJ Antibody (NBP1-89012). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RhoJ Antibody (NBP1-89012) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RhoJ Products

Bioinformatics Tool for RhoJ Antibody (NBP1-89012)

Discover related pathways, diseases and genes to RhoJ Antibody (NBP1-89012). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RhoJ Antibody (NBP1-89012)

Discover more about diseases related to RhoJ Antibody (NBP1-89012).
 

Pathways for RhoJ Antibody (NBP1-89012)

View related products by pathway.

PTMs for RhoJ Antibody (NBP1-89012)

Learn more about PTMs related to RhoJ Antibody (NBP1-89012).
 

Research Areas for RhoJ Antibody (NBP1-89012)

Find related products by research area.

Blogs on RhoJ

There are no specific blogs for RhoJ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RhoJ Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOJ