TC10 Antibody (10F7Y7) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 100-205 of human TC10 (P17081). KEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
RHOQ |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for TC10 Antibody (10F7Y7)
Background
TC10 is a member of the Rho family of GTP-binding proteins and is closely related to Cdc42 and Rac 1. Cycling between inactive and active GTP-bound state, active TC10 can directly interact with Cdc42 kinase, p21-activated protein kinases as well as other kinases (1). Constitutive expression of active TC10 mutants (TC10/Q75L) in fibroblast decrease actin stress fiber and formation of plasma membrane microspikes, while wild type TC10 has no effect on fibroblast cell morphology (2). Mostly expressed in adipose and muscle tissues, TC10 has been found to be activated by C3G (from the insulin pathway) in adipocytes (3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for TC10 Antibody (NBP3-15915) (0)
There are no publications for TC10 Antibody (NBP3-15915).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TC10 Antibody (NBP3-15915) (0)
There are no reviews for TC10 Antibody (NBP3-15915).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TC10 Antibody (NBP3-15915) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TC10 Products
Research Areas for TC10 Antibody (NBP3-15915)
Find related products by research area.
|
Blogs on TC10