![Western Blot: RhoGDI Antibody [NBP3-03348] - Western blot analysis of extracts from normal (control) and RhoGDI knockout (KO) 293T cells, using RhoGDI antibody (NBP3-03348) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/RhoGDI Antibody-Western Blot-NBP3-03348-img0002.jpg "Western Blot: RhoGDI Antibody [NBP3-03348] - Western blot analysis of extracts from normal (control) and RhoGDI knockout (KO) 293T cells, using RhoGDI antibody (NBP3-03348) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Knockout (KO) Validated Rabbit RhoGDI Antibody - BSA Free (NBP3-03348) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-204 of human RhoGDI (NP_001172006.1). MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARHGDIA |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Intracellular Staining by Flow Cytometry Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-1_AF1152_Flow_Cytometry_11328.jpg)
![Simple Western Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin1_AF1152_Simple_Western_16673.jpg)
![Immunohistochemistry Galectin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-1_AF1152_Immunohistochemistry_6684.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for RhoGDI Antibody (NBP3-03348)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ARHGDIA |
![Immunocytochemistry/ Immunofluorescence: RhoGDI Antibody - BSA Free [NBP3-03348] - Immunofluorescence analysis of HeLa cells using RhoGDI antibody (A1214). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-03348_rabbit-polyclonal-rhogdi-antibody-52202519302956.jpg "Immunocytochemistry/ Immunofluorescence: RhoGDI Antibody - BSA Free [NBP3-03348] - Immunofluorescence analysis of HeLa cells using RhoGDI antibody (A1214). Blue: DAPI for nuclear staining.")
![Western Blot XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Western_Blot_5911.jpg)
![Simple Western XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Simple_Western_16640.jpg)
![Knockout Validated XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Knockout_Validated_22488.jpg)
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")