RhoGDI Antibody - BSA Free

Western Blot: RhoGDI Antibody [NBP1-92333] - Analysis in human cell line SH-SY5Y.

Immunohistochemistry-Paraffin: RhoGDI Antibody [NBP1-92333] - Staining of human kidney shows moderate cytoplasmic positivity in renal tubules.

Analysis in human cell line SH-SY5Y.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RhoGDI Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RhoGDI Antibody - BSA Free (NBP1-92333) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSAD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGDIA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RhoGDI Protein (NBP1-92333PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RhoGDI Antibody - BSA Free

• GDIA1
• MGC117248
• Rho GDI 1
• Rho GDP dissociation inhibitor (GDI) alpha
• rho GDP-dissociation inhibitor 1
• Rho-GDI alpha
• RHOGDI
• RHOGDI-1

Background

Aplysia Ras-related homologs (ARHs), also called Rho genes, belong to the RAS gene superfamily encoding small guanine nucleotide exchange (GTP/GDP) factors. The ARH proteins may be kept in the inactive, GDP-bound state by interaction with GDP dissociation inhibitors, such as ARHGDIA (Leffers et al., 1993 [PubMed 8262133]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGDIA