RHAMM/CD168 Recombinant Protein Antigen

Images

 
There are currently no images for RHAMM/CD168 Recombinant Protein Antigen (NBP2-38459PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RHAMM/CD168 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HMMR.

Source: E.coli

Amino Acid Sequence: SSAAHTQATLLLQEKYDSMVQSLEDVTAQFESYKALTASEIEDLKLENSSLQEKVAKAGKNAEDVQHQILATESSNQEYVRMLLDLQTKSALKET

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HMMR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38459. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for RHAMM/CD168 Recombinant Protein Antigen

  • CD168 antigen
  • CD168
  • HMMR
  • hyaluronan mediated motility receptor
  • hyaluronan-mediated motility receptor (RHAMM)
  • IHABP
  • Intracellular hyaluronic acid-binding protein
  • MGC119494
  • Receptor for hyaluronan-mediated motility
  • RHAMM
  • RHAMMMGC119495

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-51635
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85418
Species: Hu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NBP2-37446
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
796-IC
Species: Mu
NBP1-43461
Species: Mu, Ha
Applications: Flow, IHC, IP
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP1-82627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38459PEP
Species: Hu
Applications: AC

Publications for RHAMM/CD168 Recombinant Protein Antigen (NBP2-38459PEP) (0)

There are no publications for RHAMM/CD168 Recombinant Protein Antigen (NBP2-38459PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHAMM/CD168 Recombinant Protein Antigen (NBP2-38459PEP) (0)

There are no reviews for RHAMM/CD168 Recombinant Protein Antigen (NBP2-38459PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for RHAMM/CD168 Recombinant Protein Antigen (NBP2-38459PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for RHAMM/CD168 Recombinant Protein Antigen (NBP2-38459PEP)

Discover related pathways, diseases and genes to RHAMM/CD168 Recombinant Protein Antigen (NBP2-38459PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHAMM/CD168 Recombinant Protein Antigen (NBP2-38459PEP)

Discover more about diseases related to RHAMM/CD168 Recombinant Protein Antigen (NBP2-38459PEP).
 

Pathways for RHAMM/CD168 Recombinant Protein Antigen (NBP2-38459PEP)

View related products by pathway.

PTMs for RHAMM/CD168 Recombinant Protein Antigen (NBP2-38459PEP)

Learn more about PTMs related to RHAMM/CD168 Recombinant Protein Antigen (NBP2-38459PEP).

Blogs on RHAMM/CD168

There are no specific blogs for RHAMM/CD168, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RHAMM/CD168 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HMMR
Entrez