RFC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RFC1 Antibody [NBP2-56364] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RFC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEII
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RFC1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RFC1 Recombinant Protein Antigen (NBP2-56364PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RFC1 Antibody

  • A1 140 kDa subunit
  • A1
  • Activator 1 140 kDa subunit
  • Activator 1 large subunit
  • Activator 1 subunit 1
  • MGC51786
  • MHC binding factor, beta
  • MHCBFB
  • PO-GA
  • RECC1
  • replication factor C (activator 1) 1 (145kD)
  • replication factor C (activator 1) 1, 145kDa
  • Replication factor C 140 kDa subunit
  • Replication factor C large subunit
  • replication factor C subunit 1
  • replication factor C1
  • RF-C 140 kDa subunit
  • RFC
  • RFC1
  • RFC140
  • RFC140DNA-binding protein PO-GA

Background

RFC1 is encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RFC1 Antibody (NBP2-56364) (0)

There are no publications for RFC1 Antibody (NBP2-56364).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFC1 Antibody (NBP2-56364) (0)

There are no reviews for RFC1 Antibody (NBP2-56364). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RFC1 Antibody (NBP2-56364) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RFC1 Products

Array NBP2-56364

Research Areas for RFC1 Antibody (NBP2-56364)

Find related products by research area.

Blogs on RFC1

There are no specific blogs for RFC1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RFC1