RFC1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RFC1 Antibody [NBP2-56364] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RFC1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEII
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RFC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RFC1 Recombinant Protein Antigen (NBP2-56364PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RFC1 Antibody - BSA Free

• A1 140 kDa subunit
• A1
• Activator 1 140 kDa subunit
• Activator 1 large subunit
• Activator 1 subunit 1
• MGC51786
• MHC binding factor, beta
• MHCBFB
• PO-GA
• RECC1
• replication factor C (activator 1) 1 (145kD)
• replication factor C (activator 1) 1, 145kDa
• Replication factor C 140 kDa subunit
• Replication factor C large subunit
• replication factor C subunit 1
• replication factor C1
• RF-C 140 kDa subunit
• RFC
• RFC1
• RFC140
• RFC140DNA-binding protein PO-GA

Background

RFC1 is encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RFC1