RFC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RFC1 Antibody [NBP2-54960] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RFC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QDVVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAIKASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RFC1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RFC1 Recombinant Protein Antigen (NBP2-54960PEP)
Publications
Read Publication using NBP2-54960.

Reactivity Notes

Mouse 81%, Rat 81%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RFC1 Antibody

  • A1 140 kDa subunit
  • A1
  • Activator 1 140 kDa subunit
  • Activator 1 large subunit
  • Activator 1 subunit 1
  • MGC51786
  • MHC binding factor, beta
  • MHCBFB
  • PO-GA
  • RECC1
  • replication factor C (activator 1) 1 (145kD)
  • replication factor C (activator 1) 1, 145kDa
  • Replication factor C 140 kDa subunit
  • Replication factor C large subunit
  • replication factor C subunit 1
  • replication factor C1
  • RF-C 140 kDa subunit
  • RFC
  • RFC1
  • RFC140
  • RFC140DNA-binding protein PO-GA

Background

RFC1 is encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59069
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-93935
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-89330
Species: Hu
Applications: IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-06290
Species: Hu
Applications: IHC, IHC-P
AF1936
Species: Hu
Applications: IP, WB
210-TA
Species: Hu
Applications: BA
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

Publications for RFC1 Antibody (NBP2-54960)(1)

Reviews for RFC1 Antibody (NBP2-54960) (0)

There are no reviews for RFC1 Antibody (NBP2-54960). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RFC1 Antibody (NBP2-54960) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RFC1 Products

Array NBP2-54960

Bioinformatics Tool for RFC1 Antibody (NBP2-54960)

Discover related pathways, diseases and genes to RFC1 Antibody (NBP2-54960). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFC1 Antibody (NBP2-54960)

Discover more about diseases related to RFC1 Antibody (NBP2-54960).
 

Pathways for RFC1 Antibody (NBP2-54960)

View related products by pathway.

PTMs for RFC1 Antibody (NBP2-54960)

Learn more about PTMs related to RFC1 Antibody (NBP2-54960).
 

Research Areas for RFC1 Antibody (NBP2-54960)

Find related products by research area.

Blogs on RFC1

There are no specific blogs for RFC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RFC1