RelA/NFkB p65 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: RelA/NFkB p65 Antibody [NBP2-56067] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
ChIP-Exo-Seq composite graph for Anti-RelA/NFkB p65 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

RelA/NFkB p65 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC
Predicted Species
Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RELA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RelA/NFkB p65 Recombinant Protein Antigen (NBP2-56067PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RelA/NFkB p65 Antibody - BSA Free

  • MGC131774
  • nf kb p65
  • NFkB p65
  • NF-kB p65
  • NFKB3
  • NFKB3v-rel avian reticuloendotheliosis viral oncogene homolog A (nuclear factor ofkappa light polypeptide gene enhancer in B-cells 3 (p65))
  • Nuclear factor NF-kappa-B p65 subunit
  • Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3transcription factor p65
  • p65
  • p65RelA
  • rela p65
  • RelA
  • v-rel reticuloendotheliosis viral oncogene homolog A (avian)
  • v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappalight polypeptide gene enhancer in B-cells 3, p65

Background

Nuclear factor B (NF-B) encompasses an important family of inducible transcriptional activators that regulate a wide variety of cellular and viral genes. The family members include p50, p52, p65 (RelA), c-Rel, and RelB. The Nf-kB p65 subunit, similar to two others in the B family, RelB and c-Rel, contains two transactivation domains in the C-terminal region of the protein. Association with inhibitory proteins of the I B family, retains NF- B in the cytoplasm. Degradation of IB proteins exposes the nuclear localization sequence (NLS), leading to nuclear translocation and subsequent binding of NF-B to DNA. In addition to the nuclear translocation and DNA binding, Nf-kB's transcriptional activity is also regulated by coactivators and corepressors in the nucleus. Interaction of p65 with coactivators; CREB-binding protein and p300, increases its transcriptional activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
NBP1-88650
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP2-01345
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
AF2699
Species: Mu
Applications: Simple Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, KO, Simple Western, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF3235
Species: Hu, Mu, Rt
Applications: IHC, WB
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NBP1-87760
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB

Publications for RelA/NFkB p65 Antibody (NBP2-56067) (0)

There are no publications for RelA/NFkB p65 Antibody (NBP2-56067).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RelA/NFkB p65 Antibody (NBP2-56067) (0)

There are no reviews for RelA/NFkB p65 Antibody (NBP2-56067). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RelA/NFkB p65 Antibody (NBP2-56067) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RelA/NFkB p65 Products

Research Areas for RelA/NFkB p65 Antibody (NBP2-56067)

Find related products by research area.

Blogs on RelA/NFkB p65.

Killing two birds with one stone: Treating inflammation and cancer by inhibiting prolyl-4-hydroxylase-1
By Jamshed Arslan Pharm.D. The cell’s oxygen-sensing machinery comprises prolyl-4-hydroxylases (P4Hs 1-3, PHDs 1-3, or EGLN 1-3) and their canonical target hypoxia-inducible factors (HIFs). When oxygen levels ...  Read full blog post.

The effect of antioxidants and the NFkB p65 pathway in inflammation
NFkB is a transcription factor that plays a role in the expression of genes involved in immune response, inflammation, metastasis, cell survival and more. RelA (p65) is one member of the NFkB mammalian family, alongside other subunits. NFkB subunit...  Read full blog post.

NFkB3-p65: Say that three times fast!
NF-kappa-B is a ubiquitous transcription factor involved in several biological processes such as inflammation, immunity, differentiation, cell growth, tumor genesis and apoptosis. Unlike the majority of transcription factors that reside in the nucleus...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RelA/NFkB p65 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol RELA