Recombinant Human CD44v6 His-tag Protein, CF

Images

 
Recombinant Human CD44v6 His-tag (Catalog # 11237-CD) has a molecular weight (MW) of 48.4 kDa as analyzed by SEC-MALS, suggesting that this protein is a monomer. MW may differ from predicted MW due to post-translational ...read more
Measured by its binding ability in a functional ELISA. When Recombinant Human CD44v6 His-tag Protein (Catalog # 11237-CD) is immobilized at 0.50 ug/mL (100 uL/well), Recombinant Human LSECtin/CLEC4G Protein (2947-CL) ...read more
2 μg/lane of Recombinant Human CD44v6 His-tag Protein (Catalog # 11237-CD) was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by Coomassie® Blue staining, showing bands ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Bioactivity
Format
Carrier-Free

Order Details

Recombinant Human CD44v6 His-tag Protein, CF Summary

Details of Functionality
Measured by its binding ability in a functional ELISA. When Recombinant Human CD44v6 His-tag (Catalog # 11237-CD) is immobilized at 0.500 μg/mL (100 μL/well), Recombinant Human LSECtin/CLEC4G  (Catalog # 2947-CL) binds with an ED50 of 3.00-15.0 ng/mL.
Source
Chinese Hamster Ovary cell line, CHO-derived human CD44 protein
Human CD44v6
(Gln21-Thr222)
IQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAG
(Asp224-Trp269)
Accession # NP_001001391.1
6-His tag
N-terminusC-terminus
Accession #
N-terminal Sequence
Gln21
Protein/Peptide Type
Recombinant Proteins
Purity
>95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining
Endotoxin Note
<0.10 EU per 1 μg of the protein by the LAL method.

Applications/Dilutions

Dilutions
  • Bioactivity
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
SDS-PAGE
53-76 kDa, under reducing conditions.

Packaging, Storage & Formulations

Storage
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
  • 12 months from date of receipt, -20 to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
  • 3 months, -20 to -70 °C under sterile conditions after reconstitution.
Buffer
Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Purity
>95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining
Reconstitution Instructions
Reconstitute at 500 μg/mL in PBS.

Notes

This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.

Alternate Names for Recombinant Human CD44v6 His-tag Protein, CF

  • CD44 antigen
  • CD44 molecule (Indian blood group)
  • CD44
  • CD44R
  • CDw44
  • cell surface glycoprotein CD44
  • chondroitin sulfate proteoglycan 8
  • CSPG8
  • ECMR-III
  • epican
  • Extracellular matrix receptor III
  • GP90 lymphocyte homing/adhesion receptor
  • HCAM
  • HCELL
  • hematopoietic cell E- and L-selectin ligand
  • Heparan sulfate proteoglycan
  • Hermes antigen
  • homing function and Indian blood group system
  • HUTCH-I
  • Hyaluronate receptor
  • IN
  • LHR
  • MC56
  • MDU2
  • MDU2CD44 antigen (homing function and Indian blood group system)
  • MDU3
  • MDU3CDW44
  • MIC4
  • MIC4MGC10468
  • MUTCH-I
  • Pgp1
  • PGP-1
  • PGP-I
  • Phagocytic glycoprotein 1
  • Phagocytic glycoprotein I

Background

CD44 is a ubiquitously expressed protein that is the major receptor for hyaluronan and exerts control over cell growth and migration (1-3). Human CD44 has a 20 amino acid (aa) signal sequence, an extracellular domain (ECD) with a 100 aa hyaluronan-binding disulfide-stabilized link region and a 325-530 aa stem region, a 21 aa transmembrane domain, and a 72 aa cytoplasmic domain. CD44 transcripts undergo complex alternative splicing, and, within the stem, ten variably spliced exons (v1-10 corresponding to exons 6-15; although human CD44 lacks v1/exon 6) produce multiple protein isoforms (1-4). The standard or hematopoietic form, CD44H, does not include the variable segments (1-4). Cancer aggressiveness and T cell activation have been correlated with expression of specific isoforms (1, 4, 5). Human CD44v6 contains exon 11 (v6) and is involved in many biological processes including cell growth, apoptosis, and metastasis (6-7). With variable N- and O-glycosylation and splicing within the stalk, CD44 can range from 80 to 200 kDa (1). Within the N-terminal invariant portion of the ECD (aa 21-222), human CD44 shares 76%, 76%, 86%, 83% and 79% identity with corresponding mouse, rat, equine, canine and bovine CD44, respectively. The many reported functions of CD44 fall within three categories (1). First, CD44 binds hyaluronan and other ligands within the extracellular matrix and can function as a "platform" for growth factors and metalloproteinases. Second, CD44 can function as a co-receptor that modifies activity of receptors including MET and the ERBB family of tyrosine kinases. Third, the CD44 intracellular domain links the plasma membrane to the actin cytoskeleton via the ERM proteins, ezrin, radixin and moesin. CD44 can be synthesized in a soluble form (8) or may be cleaved at multiple sites by either membrane-type matrix metalloproteinases, or ADAM proteases to produce soluble ectodomains (9-10). The cellular portion may then undergo gamma secretase-dependent intramembrane cleavage to form an A beta-like transmembrane portion and a cytoplasmic signaling portion that affects gene expression (11-12). These cleavage events are thought to promote metastasis by enhancing tumor cell motility and growth (1, 8). CD44v6 plays an important role in colorectal cancer progression involving in cell colonization, invasion, and metastasis and is considered a functional cancer biomarker (7).
  1. Ponta, H. et al. (2003) Nat. Rev. Mol. Cell Biol. 4:33.
  2. Screaton, G.R. et al. (1992) Proc. Natl. Acad. Sci. USA 89:12160.
  3. Screaton, G.R. et al. (1993) J. Biol. Chem. 268:12235.
  4. Lynch, K.W. (2004) Nat. Rev. Immunol. 4:931.
  5. Todaro, M. et al. (2014) Cell stem cell 14:342.
  6. Vizoso, F.J. et al. (2004) J. Cancer Res. Clin. Oncol. 130:679.
  7. Ma, L. et al. (2019) Cell Death Dis. 10:30.
  8. Yu, Q. and B.P. Toole (1996) J. Biol. Chem. 271:20603.
  9. Nagano, O. and H. Saya (2004) Cancer Sci. 95:930.
  10. Nakamura, H. et al. (2004) Cancer Res. 64:876.
  11. Murakami, D. et al. (2003) Oncogene 22:1511.
  12. Lammich, S. et al. (2002) J. Biol. Chem. 277:44754.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF796
Species: Mu
Applications: AdBlk, IHC, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
BBA24
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
202-IL
Species: Hu
Applications: BA
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
AF4117
Species: Rt
Applications: IHC, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
AF5247
Species: Hu
Applications: IHC, WB
MAB3595
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
MAB2965
Species: Hu
Applications: CyTOF-ready, Flow
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
M6000B
Species: Mu
Applications: ELISA
AF2364
Species: Hu
Applications: IHC, WB

Publications for CD44 (11237-CD) (0)

There are no publications for CD44 (11237-CD).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD44 (11237-CD) (0)

There are no reviews for CD44 (11237-CD). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD44 (11237-CD) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD44 Products

Blogs on CD44.

Taking Biomarker Discovery From 2D to 3D: Increased Biological Activity of EVs Isolated From 3D Prostate Cancer Cultures
Jamshed Arslan, Pharm D, PhD Tissues within the human body are made of a three-dimensional (3D) arrangement of cells working together to perform vital functions. The commonly used 2D monolayer cultures have limited ...  Read full blog post.

Stemness is responsible for onset and metastasis of colorectal cancer
By Jamshed Arslan, Pharm. D., PhD. Colorectal cancer stem cells are a rare subpopulation of colorectal cancer cells that can self-renew and initiate and sustain tumor growth when transplanted into an animal host.1,2 C...  Read full blog post.

The Osteopontin Antibody and Hepatic Research
Antibody suppliers, such as us at Novus Biologicals, supply a wide range of cell marker products, among them the Osteopontin antibody. Recently, the osteopontin antibody has proven useful in hepatic cancer research.Osteopontin (OPN) is mainly expres...  Read full blog post.

CD Antibodies Uncover Markers for Rare Breast Cancer
We at Novus Biologicals have added several new products to our CD antibody database. The CD, or Cluster of Differential proteins are a family of type I transmembrane glycoproteins widely expressed in immune cell populations. These include B cells, thy...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD44v6 His-tag Protein, CF and receive a gift card or discount.

Bioinformatics

Uniprot