Recombinant Human CD44v6 Fc Chimera Protein, CF

When Recombinant Human CD44v6 Fc Chimera Protein (Catalog # 11175-CD) is immobilized at 1 µg/mL (100 µL/well), Biotinylated Hyaluronan binds with an ED50 of 4.00-40.0 ng/mL.

2 μg/lane of Recombinant Human CD44v6 Fc Chimera Protein (Catalog # 11175-CD) was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by Coomassie® Blue staining, showing bands at 105-120 kDa and 210-240 kDa, respectively.

• Reactivity: Hu
• Applications: Bioactivity
• Format: Carrier-Free

Recombinant Human CD44v6 Fc Chimera Protein, CF Summary

• Details of Functionality: Measured by its binding ability in a functional ELISA. When Recombinant Human CD44v6 Fc Chimera (Catalog # 11175-CD) is immobilized at 1 µg/mL (100 µL/well), Biotinylated Hyaluronan binds with an ED₅₀ of 4.00-40.0 ng/mL.
• Source: Chinese Hamster Ovary cell line, CHO-derived human CD44 protein
  

  Human CD44v6 (Gln21-Thr222) (IQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAG)(Asp224-Trp269) Accession # NP_001001391.1	GGIEGRMD	Human IgG1 (Pro100-Lys330)
  N-terminus		C-terminus

• Accession #: NP_001001391.1
• N-terminal Sequence: Gln21
• Structure / Form: Disulfide-linked homodimer
• Protein/Peptide Type: Recombinant Proteins
• Purity: >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining
• Endotoxin Note: <0.10 EU per 1 μg of the protein by the LAL method.

Applications/Dilutions

• Dilutions:
  • Bioactivity
• Theoretical MW: 59 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• SDS-PAGE: 105-120 kDa, under reducing conditions.

Packaging, Storage & Formulations

• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
  • 12 months from date of receipt, -20 to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
  • 3 months, -20 to -70 °C under sterile conditions after reconstitution.
• Buffer: Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
• Purity: >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining
• Reconstitution Instructions: Reconstitute at 500 μg/mL in PBS.

Notes

This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.

Alternate Names for Recombinant Human CD44v6 Fc Chimera Protein, CF

• CD44 antigen
• CD44 molecule (Indian blood group)
• CD44
• CD44R
• CDw44
• cell surface glycoprotein CD44
• chondroitin sulfate proteoglycan 8
• CSPG8
• ECMR-III
• Epican
• Extracellular matrix receptor III
• GP90 lymphocyte homing/adhesion receptor
• HCAM
• HCELL
• hematopoietic cell E- and L-selectin ligand
• Heparan sulfate proteoglycan
• Hermes antigen
• homing function and Indian blood group system
• HUTCH-I
• Hyaluronate receptor
• IN
• LHR
• MC56
• MDU2
• MDU2CD44 antigen (homing function and Indian blood group system)
• MDU3
• MDU3CDW44
• MIC4
• MIC4MGC10468
• MUTCH-I
• Pgp1
• PGP-1
• PGP-I
• Phagocytic glycoprotein 1
• Phagocytic glycoprotein I

Background

CD44 is a ubiquitously expressed protein that is the major receptor for hyaluronan and exerts control over cell growth and migration (1-3). Human CD44 has a 20 amino acid (aa) signal sequence, an extracellular domain (ECD) with a 100 aa hyaluronan-binding disulfide-stabilized link region and a 325-530 aa stem region, a 21 aa transmembrane domain, and a 72 aa cytoplasmic domain. CD44 transcripts undergo complex alternative splicing, and, within the stem, ten variably spliced exons (v1‑10 corresponding to exons 6-15; although human CD44 lacks v1/exon 6) produce multiple protein isoforms (1-4). The standard or hematopoietic form, CD44H, does not include the variable segments (1-4). Cancer aggressiveness and T cell activation have been correlated with expression of specific isoforms (1, 4, 5). Human CD44v6 contains exon 11 (v6) and is involved in many biological processes including cell growth, apoptosis, and metastasis (6-7). With variable N- and O‑glycosylation and splicing within the stalk, CD44 can range from 80 to 200 kDa (1). Within the N-terminal invariant portion of the ECD (aa 21-222), human CD44 shares 76%, 76%, 86%, 83% and 79% identity with corresponding mouse, rat, equine, canine and bovine CD44, respectively. The many reported functions of CD44 fall within three categories (1). First, CD44 binds hyaluronan and other ligands within the extracellular matrix and can function as a "platform" for growth factors and metalloproteinases. Second, CD44 can function as a co-receptor that modifies activity of receptors including MET and the ERBB family of tyrosine kinases. Third, the CD44 intracellular domain links the plasma membrane to the actin cytoskeleton via the ERM proteins, ezrin, radixin and moesin. CD44 can be synthesized in a soluble form (8) or may be cleaved at multiple sites by either membrane-type matrix metalloproteinases, or ADAM proteases to produce soluble ectodomains (9-10). The cellular portion may then undergo gamma secretase-dependent intramembrane cleavage to form an A beta-like transmembrane portion and a cytoplasmic signaling portion that affects gene expression (11‑12). These cleavage events are thought to promote metastasis by enhancing tumor cell motility and growth (1, 8). CD44v6 plays an important role in colorectal cancer progression involving in cell colonization, invasion, and metastasis and is considered a functional cancer biomarker (7).

1. Ponta, H. et al. (2003) Nat. Rev. Mol. Cell Biol. 4:33.
2. Screaton, G.R. et al. (1992) Proc. Natl. Acad. Sci. USA 89:12160.
3. Screaton, G.R. et al. (1993) J. Biol. Chem. 268:12235.
4. Lynch, K.W. (2004) Nat. Rev. Immunol. 4:931.
5. Todaro, M. et al. (2014) Cell stem cell 14:342.
6. Vizoso, F.J. et al. (2004) J. Cancer Res. Clin. Oncol. 130:679.
7. Ma, L. et al. (2019) Cell Death Dis. 10:30.
8. Yu, Q. and B.P. Toole (1996) J. Biol. Chem. 271:20603.
9. Nagano, O. and H. Saya (2004) Cancer Sci. 95:930.
10. Nakamura, H. et al. (2004) Cancer Res. 64:876.
11. Murakami, D. et al. (2003) Oncogene 22:1511.
12. Lammich, S. et al. (2002) J. Biol. Chem. 277:44754.

Bioinformatics

• Uniprot:
  • NP_001001391.1()