RDM1 Antibody

Images

 
Western Blot: RDM1 Antibody [NBP1-82708] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: RDM1 Antibody [NBP1-82708] - Staining of human cell line A-431 shows positivity in nucleoli.
Immunohistochemistry-Paraffin: RDM1 Antibody [NBP1-82708] - Staining of human kidney shows moderate cytoplasmic positivity in tubule cells.

Product Details

Summary
Product Discontinued
View other related RDM1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-82708
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RDM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SPVKVRLGTRHKAVQHQALALNSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RDM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RDM1 Antibody

  • MGC33977
  • RAD52 homolog B (S. cerevisiae)
  • RAD52 homolog B
  • RAD52 motif 1
  • RAD52 motif-containing protein 1
  • RAD52B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60017
Species: Mu, Rt, Bv(-), Ca(-), Hu(-), Po(-), Rb(-), Sh(-)
Applications: WB, ICC/IF, IHC, IHC-Fr
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-58116
Species: Hu
Applications: ICC/IF
NBP2-57022
Species: Hu
Applications: WB, ICC/IF
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
AF6817
Species: Hu
Applications: WB
H00003090-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33402
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00006603-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77146
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82708
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RDM1 Antibody (NBP1-82708) (0)

There are no publications for RDM1 Antibody (NBP1-82708).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RDM1 Antibody (NBP1-82708) (0)

There are no reviews for RDM1 Antibody (NBP1-82708). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RDM1 Antibody (NBP1-82708) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RDM1 Products

Bioinformatics Tool for RDM1 Antibody (NBP1-82708)

Discover related pathways, diseases and genes to RDM1 Antibody (NBP1-82708). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RDM1 Antibody (NBP1-82708)

Discover more about diseases related to RDM1 Antibody (NBP1-82708).
 

Pathways for RDM1 Antibody (NBP1-82708)

View related products by pathway.

PTMs for RDM1 Antibody (NBP1-82708)

Learn more about PTMs related to RDM1 Antibody (NBP1-82708).

Blogs on RDM1

There are no specific blogs for RDM1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RDM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RDM1