HIC1 Antibody (4E11)

Images

 
Western Blot: HIC1 Antibody (4E11) [H00003090-M01] - HIC1 monoclonal antibody (M01), clone 4E11 Analysis of HIC1 expression in Jurkat.
Immunocytochemistry/ Immunofluorescence: HIC1 Antibody (4E11) [H00003090-M01] - Analysis of monoclonal antibody to HIC1 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: HIC1 Antibody (4E11) [H00003090-M01] - HIC1 monoclonal antibody (M01), clone 4E11. Analysis of HIC1 expression in PC-12.
Sandwich ELISA: HIC1 Antibody (4E11) [H00003090-M01] - Detection limit for recombinant GST tagged HIC1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
4E11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HIC1 Antibody (4E11) Summary

Immunogen
HIC1 (NP_006488, 396 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YKSSSEETGSSEDPSPPGGHLEGYPCPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLN
Specificity
HIC1 (4E11)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HIC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publication using H00003090-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HIC1 Antibody (4E11)

  • hic-1
  • hypermethylated in cancer 1
  • ZBTB29hypermethylated in cancer 1 protein
  • Zinc finger and BTB domain-containing protein 29
  • ZNF901

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
NB100-168
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-66987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-76835
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
H00029107-M08
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
MAB3765
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, Simple Western, WB
NBP3-15267
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NB100-56637
Species: Hu, Mu
Applications: WB
292-G2
Species: Hu
Applications: BA

Publications for HIC1 Antibody (H00003090-M01)(1)

Reviews for HIC1 Antibody (H00003090-M01) (0)

There are no reviews for HIC1 Antibody (H00003090-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HIC1 Antibody (H00003090-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HIC1 Products

Array H00003090-M01

Bioinformatics Tool for HIC1 Antibody (H00003090-M01)

Discover related pathways, diseases and genes to HIC1 Antibody (H00003090-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIC1 Antibody (H00003090-M01)

Discover more about diseases related to HIC1 Antibody (H00003090-M01).
 

Pathways for HIC1 Antibody (H00003090-M01)

View related products by pathway.

PTMs for HIC1 Antibody (H00003090-M01)

Learn more about PTMs related to HIC1 Antibody (H00003090-M01).
 

Research Areas for HIC1 Antibody (H00003090-M01)

Find related products by research area.

Blogs on HIC1

There are no specific blogs for HIC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HIC1 Antibody (4E11) and receive a gift card or discount.

Bioinformatics

Gene Symbol HIC1
Entrez
OMIM
Uniprot