RCOR2 Antibody

Images

 
Western Blot: RCOR2 Antibody [NBP1-74099] - Titration: 1.0 ug/ml Positive Control: Mouse Small Intestine.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB, IHC-FrFl
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RCOR2 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Rcor2. Immunizing peptide sequence PPEANTKFNSRWTTDEQLLAVQAIRRYGKDFGAIAEVIGNKTLTQVKTFF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RCOR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry Free-Floating
Application Notes
This is a rabbit polyclonal antibody against Rcor2 and was validated on Western blot. Use in Immunohistochemistry free floating reported in scientific literature (PMID 26795843).
Theoretical MW
53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-74099 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RCOR2 Antibody

  • CoREST2
  • REST corepressor 2

Background

Rcor2 may act as a component of a corepressor complex that represses transcription potential.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-240
Species: Hu
Applications: WB, IHC-P, PLA
NB100-757
Species: Hu
Applications: WB, IHC-P
NB100-1762
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46429
Species: Hu
Applications: WB, IHC, IF
H00010362-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00006326-Q01
Species: Hu
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-56179
Species: Hu
Applications: ICC/IF
NBP1-87227
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
AF2156
Species: Hu, Mu
Applications: WB, IHC
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-39015
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-27173
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, IHC-P
NBP2-07900
Species: Hu

Publications for RCOR2 Antibody (NBP1-74099)(1)

Reviews for RCOR2 Antibody (NBP1-74099) (0)

There are no reviews for RCOR2 Antibody (NBP1-74099). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RCOR2 Antibody (NBP1-74099) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RCOR2 Products

Bioinformatics Tool for RCOR2 Antibody (NBP1-74099)

Discover related pathways, diseases and genes to RCOR2 Antibody (NBP1-74099). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RCOR2 Antibody (NBP1-74099)

Discover more about diseases related to RCOR2 Antibody (NBP1-74099).
 

Pathways for RCOR2 Antibody (NBP1-74099)

View related products by pathway.

PTMs for RCOR2 Antibody (NBP1-74099)

Learn more about PTMs related to RCOR2 Antibody (NBP1-74099).

Blogs on RCOR2

There are no specific blogs for RCOR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RCOR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RCOR2