RBP5 Antibody - BSA Free

Western Blot: RBP5 Antibody [NBP2-32643] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: RBP5 Antibody [NBP2-32643] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles.

Immunohistochemistry-Paraffin: RBP5 Antibody [NBP2-32643] - Staining in human kidney and pancreas tissues using anti-RBP5 antibody. Corresponding RBP5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: RBP5 Antibody [NBP2-32643] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: RBP5 Antibody [NBP2-32643] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RBP5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RBP5 Antibody - BSA Free (NBP2-32643) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBP5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RBP5 Protein (NBP2-32643PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RBP5 Antibody - BSA Free

• Cellular retinol-binding protein III
• CRBP3
• CRBPIII
• CRBP-III
• HRBPiso
• putative cellular retinol-binding protein CRBP III
• retinol binding protein 5, cellular
• retinol-binding protein 5
• retinol-binding protein 5, cellular

Background

Intracellular transport of retinol

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBP5