RBP5 Antibody

Images

 
Western Blot: RBP5 Antibody [NBP2-32643] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: RBP5 Antibody [NBP2-32643] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: RBP5 Antibody [NBP2-32643] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBP5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBP5 Protein (NBP2-32643PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBP5 Antibody

  • Cellular retinol-binding protein III
  • CRBP3
  • CRBPIII
  • CRBP-III
  • HRBPiso
  • putative cellular retinol-binding protein CRBP III
  • retinol binding protein 5, cellular
  • retinol-binding protein 5
  • retinol-binding protein 5, cellular

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00482
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NB600-250
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
AF5810
Species: Hu, Mu
Applications: WB, IHC
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84383
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-252
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-22294
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-545
Species: Hu
Applications: WB, IHC-P, IP
NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
NB100-2579
Species: Hu, Mu
Applications: WB, IHC, IP, PLA
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-50444
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
AF6349
Species: Hu, Mu, Rt
Applications: WB
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
AF3075
Species: Hu
Applications: WB, ICC
AF7550
Species: Hu
Applications: WB
NBP2-32643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RBP5 Antibody (NBP2-32643) (0)

There are no publications for RBP5 Antibody (NBP2-32643).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBP5 Antibody (NBP2-32643) (0)

There are no reviews for RBP5 Antibody (NBP2-32643). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBP5 Antibody (NBP2-32643) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBP5 Products

Bioinformatics Tool for RBP5 Antibody (NBP2-32643)

Discover related pathways, diseases and genes to RBP5 Antibody (NBP2-32643). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBP5 Antibody (NBP2-32643)

Discover more about diseases related to RBP5 Antibody (NBP2-32643).
 

Pathways for RBP5 Antibody (NBP2-32643)

View related products by pathway.

PTMs for RBP5 Antibody (NBP2-32643)

Learn more about PTMs related to RBP5 Antibody (NBP2-32643).

Blogs on RBP5

There are no specific blogs for RBP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBP5