RBP7 Antibody

Images

 
Western Blot: RBP7 Antibody [NBP1-84383] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383] - Staining of human adrenal gland shows strong nuclear positivity in cortical cells.
Western Blot: RBP7 Antibody [NBP1-84383] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBP7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBP7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RBP7 Protein (NBP1-84383PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBP7 Antibody

  • Cellular retinoic acid-binding protein 4
  • Cellular retinoic acid-binding protein IV
  • CRABP4
  • CRABP-IV
  • CRBP4
  • CRBPIV
  • MGC70641
  • putative cellular retinol-binding protein CRBP IV
  • retinoid binding protein 7
  • retinoid-binding protein 7
  • retinol binding protein 7, cellular

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16372
Species: Hu
Applications: WB, IHC-P
H00064802-B01P
Species: Hu, Ha
Applications: WB, ELISA, ICC/IF
NBP2-32643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF885
Species: Hu
Applications: WB, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-86617
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
AF5346
Species: Hu
Applications: WB
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP1-85464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-41312
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-04299
Species: Hu
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-80851
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84383
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RBP7 Antibody (NBP1-84383) (0)

There are no publications for RBP7 Antibody (NBP1-84383).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBP7 Antibody (NBP1-84383) (0)

There are no reviews for RBP7 Antibody (NBP1-84383). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBP7 Antibody (NBP1-84383) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBP7 Products

Bioinformatics Tool for RBP7 Antibody (NBP1-84383)

Discover related pathways, diseases and genes to RBP7 Antibody (NBP1-84383). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBP7 Antibody (NBP1-84383)

Discover more about diseases related to RBP7 Antibody (NBP1-84383).
 

Pathways for RBP7 Antibody (NBP1-84383)

View related products by pathway.

PTMs for RBP7 Antibody (NBP1-84383)

Learn more about PTMs related to RBP7 Antibody (NBP1-84383).

Blogs on RBP7

There are no specific blogs for RBP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBP7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBP7