RBP7 Antibody

Western Blot: RBP7 Antibody [NBP1-84383] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383] - Staining of human prostate shows moderate nuclear positivity in glandular cells.

Western Blot: RBP7 Antibody [NBP1-84383] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383] - Analysis in human breast and pancreas tissues. Corresponding RBP7 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383] - Staining of human breast shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383] - Staining of human kidney shows moderate nuclear positivity in cells in tubules and cells in glomeruli.

Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RBP7 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBP7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RBP7 Protein (NBP1-84383PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RBP7 Antibody

• Cellular retinoic acid-binding protein 4
• Cellular retinoic acid-binding protein IV
• CRABP4
• CRABP-IV
• CRBP4
• CRBPIV
• MGC70641
• putative cellular retinol-binding protein CRBP IV
• retinoid binding protein 7
• retinoid-binding protein 7
• retinol binding protein 7, cellular

Background

Due to its chemical instability and low solubility in aqueous solution, vitamin A requires cellular retinol-binding proteins (CRBPs), such as RBP7, for stability, internalization, intercellular transfer, homeostasis, and metabolism.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBP7