RBP7 Antibody


Western Blot: RBP7 Antibody [NBP1-84383] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383] - Staining in human breast and pancreas tissues using anti-RBP7 antibody. Corresponding RBP7 RNA-seq data are presented for the same tissues.
Western Blot: RBP7 Antibody [NBP1-84383] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383] - Staining of human adrenal gland shows strong nuclear positivity in cortical cells.
Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383] - Staining of human breast shows high expression.
Immunohistochemistry-Paraffin: RBP7 Antibody [NBP1-84383] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

RBP7 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEK
Specificity of human, mouse, rat RBP7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RBP7 Protein (NBP1-84383PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RBP7 Antibody

  • Cellular retinoic acid-binding protein 4
  • Cellular retinoic acid-binding protein IV
  • CRABP4
  • CRBP4
  • MGC70641
  • putative cellular retinol-binding protein CRBP IV
  • retinoid binding protein 7
  • retinoid-binding protein 7
  • retinol binding protein 7, cellular


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC-P
Species: Hu, Ha
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RBP7 Antibody (NBP1-84383) (0)

There are no publications for RBP7 Antibody (NBP1-84383).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBP7 Antibody (NBP1-84383) (0)

There are no reviews for RBP7 Antibody (NBP1-84383). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBP7 Antibody (NBP1-84383) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RBP7 Products

Bioinformatics Tool for RBP7 Antibody (NBP1-84383)

Discover related pathways, diseases and genes to RBP7 Antibody (NBP1-84383). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBP7 Antibody (NBP1-84383)

Discover more about diseases related to RBP7 Antibody (NBP1-84383).

Pathways for RBP7 Antibody (NBP1-84383)

View related products by pathway.

PTMs for RBP7 Antibody (NBP1-84383)

Learn more about PTMs related to RBP7 Antibody (NBP1-84383).

Blogs on RBP7

There are no specific blogs for RBP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RBP7 Antibody and receive a gift card or discount.


Gene Symbol RBP7