RBM25 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RBM25 Antibody [NBP1-83418] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Simple Western: RBM25 Antibody [NBP1-83418] - Simple Western lane view shows a specific band for RBM25 in 0.2 mg/ml of MOLT-4 (left) and A431 (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: RBM25 Antibody [NBP1-83418] - Electropherogram image of the corresponding Simple Western lane view. RBM25 antibody was used at 1:25 dilution on MOLT-4 and A431 lysate(s) respectively.

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MOLT-4

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RBM25 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RBM25 Antibody - BSA Free (NBP1-83418) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PVDSVFNKFEDEDSDDVPRKRKLVPLDYGEDDKNATKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEV
• Predicted Species: Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM25
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:25
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in MOLT-4 and A431 lysates, separated by Size, antibody dilution of 1:25, apparent MW was 141-144 kDa.
• Control Peptide:

  RBM25 Protein (NBP1-83418PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RBM25 Antibody - BSA Free

• Arg/Glu/Asp-rich protein of 120 kDa
• Arg/Glu/Asp-rich protein, 120 kDa
• fSAP94
• functional spliceosome-associated protein 94
• MGC105088
• MGC117168
• NET52
• Protein S164
• RED120RNA-binding region-containing protein 7
• RNA binding motif protein 25
• RNA-binding motif protein 25
• RNA-binding protein 25
• RNA-binding region (RNP1, RRM) containing 7
• RNPC7
• S164
• Snu71
• U1 small nuclear ribonucleoprotein 1SNRP homolog

Background

RBM25, also identified as hRED120 (for human Arg/Glu/Asp-rich protein of 120 kDa), contains an RNA recognition motif and a PWI nucleic acid binding domain and is suggested to have a role in RNA processing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBM25