RBM25 Antibody

Images

 
Western Blot: RBM25 Antibody [NBP1-83418] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line MOLT-4
Immunocytochemistry/ Immunofluorescence: RBM25 Antibody [NBP1-83418] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: RBM25 Antibody [NBP1-83418] - Staining of human pancreas shows strong nuclear and moderate cytoplasmic positivity in exocrine glandular cells and Islet cells.
Simple Western: RBM25 Antibody [NBP1-83418] - Simple Western lane view shows a specific band for RBM25 in 0.2 mg/ml of MOLT-4 (left) and A431 (right) lysate(s). This experiment was performed under reducing conditions ...read more
Simple Western: RBM25 Antibody [NBP1-83418] - Electropherogram image of the corresponding Simple Western lane view. RBM25 antibody was used at 1:25 dilution on MOLT-4 and A431 lysate(s) respectively.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBM25 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PVDSVFNKFEDEDSDDVPRKRKLVPLDYGEDDKNATKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM25
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000 - 1:2500
  • Simple Western 1:25
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size.
Control Peptide
RBM25 Protein (NBP1-83418PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM25 Antibody

  • Arg/Glu/Asp-rich protein of 120 kDa
  • Arg/Glu/Asp-rich protein, 120 kDa
  • fSAP94
  • functional spliceosome-associated protein 94
  • MGC105088
  • MGC117168
  • NET52
  • Protein S164
  • RED120RNA-binding region-containing protein 7
  • RNA binding motif protein 25
  • RNA-binding motif protein 25
  • RNA-binding protein 25
  • RNA-binding region (RNP1, RRM) containing 7
  • RNPC7
  • S164
  • Snu71
  • U1 small nuclear ribonucleoprotein 1SNRP homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13381
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88053
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84752
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP2-57100
Species: Hu
Applications: ICC/IF
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-37962
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87933
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-83418
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for RBM25 Antibody (NBP1-83418) (0)

There are no publications for RBM25 Antibody (NBP1-83418).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM25 Antibody (NBP1-83418) (0)

There are no reviews for RBM25 Antibody (NBP1-83418). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM25 Antibody (NBP1-83418) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM25 Products

Bioinformatics Tool for RBM25 Antibody (NBP1-83418)

Discover related pathways, diseases and genes to RBM25 Antibody (NBP1-83418). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM25 Antibody (NBP1-83418)

Discover more about diseases related to RBM25 Antibody (NBP1-83418).
 

Pathways for RBM25 Antibody (NBP1-83418)

View related products by pathway.

Blogs on RBM25

There are no specific blogs for RBM25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM25