CROP Antibody - BSA Free

Western Blot: CROP Antibody [NBP1-88052] - Analysis using Anti-LUC7L3 antibody NBP1-88052 (A) shows similar pattern to independent antibody NBP1-88053 (B).

Immunohistochemistry-Paraffin: CROP Antibody [NBP1-88052] - Staining of human kidney.

Immunohistochemistry-Paraffin: CROP Antibody [NBP1-88052] - Staining of human lymph node.

Immunohistochemistry-Paraffin: CROP Antibody [NBP1-88052] - Staining of human colon.

Immunohistochemistry-Paraffin: CROP Antibody [NBP1-88052] - Staining of human cerebral cortex.

Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Staining of human cerebral cortex, gastrointestinal, kidney and lymphoid tissues using Anti-LUC7L3 antibody NBP1-88052 (A) shows similar protein distribution across tissues to independent antibody NBP1-88051 (B).

Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.

Staining of human colon shows strong nuclear positivity in glandular cells.

Staining of human kidney shows strong nuclear positivity in cells in tubules and glomeruli.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CROP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CROP Antibody - BSA Free (NBP1-88052) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEEPDRDERLKKEKQEREEREKEREREREERER
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LUC7L3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CROP Protein (NBP1-88052PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CROP Antibody - BSA Free

• cAMP regulatory element-associated protein 1
• cisplatin resistance associated overexpressed protein
• cisplatin resistance-associated overexpressed protein
• Cisplatin resistance-associated-overexpressed protein
• CREAP1
• CREAP-1LUC7ACRA
• CRE-associated protein 1
• CROPFLJ11063
• hLuc7A
• Luc7A
• LUC7-like 3 (S. cerevisiae)
• luc7-like protein 3
• O48
• OA48-18
• Okadaic acid-inducible phosphoprotein OA48-18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LUC7L3