RASL12 Antibody (NBP1-98570)

Images

 
Western Blot: RASL12 Antibody [NBP1-98570] - Mouse Heart Lysate 1.0ug/ml, Gel Concentration: 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RASL12 Antibody Summary

Immunogen
The immunogen for this antibody is Rasl12 - N-terminal region. Peptide sequence DPNLEDTYSSEETVDHQPVHLRVMDTADLDTPRNCERYLNWAHAFLVVYS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASL12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RASL12 Antibody

  • Ras family member Ris
  • ras-like protein family member 12
  • RAS-like, family 12
  • RISRas-like protein Ris

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13245
Species: Hu
Applications: IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
AF4036
Species: Hu
Applications: WB, Simple Western
NBP2-57200
Species: Hu
Applications: ICC/IF
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-16463
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57512
Species: Hu
Applications: WB, ICC/IF
NBP1-60046
Species: Hu, Mu, Rt, Po, Bv, Eq, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83368
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83957
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-27348
Species: Hu
Applications: WB
H00000251-M07
Species: Hu
Applications: WB, ELISA, IHC-P, IP, RNAi
NBP1-88769
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-98570
Species: Mu
Applications: WB

Publications for RASL12 Antibody (NBP1-98570) (0)

There are no publications for RASL12 Antibody (NBP1-98570).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASL12 Antibody (NBP1-98570) (0)

There are no reviews for RASL12 Antibody (NBP1-98570). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RASL12 Antibody (NBP1-98570) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RASL12 Antibody Products

Related Products by Gene

Bioinformatics Tool for RASL12 Antibody (NBP1-98570)

Discover related pathways, diseases and genes to RASL12 Antibody (NBP1-98570). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RASL12

There are no specific blogs for RASL12, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASL12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASL12
Uniprot

Customers Who Bought This Also Bought