RASL12 Antibody

Images

 
Western Blot: RASL12 Antibody [NBP1-98570] - Mouse Heart Lysate 1.0ug/ml, Gel Concentration: 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

RASL12 Antibody Summary

Immunogen
The immunogen for this antibody is Rasl12 - N-terminal region. Peptide sequence DPNLEDTYSSEETVDHQPVHLRVMDTADLDTPRNCERYLNWAHAFLVVYS.
Clonality
Polyclonal
Host
Rabbit
Gene
RASL12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RASL12 Antibody

  • Ras family member Ris
  • ras-like protein family member 12
  • RAS-like, family 12
  • RISRas-like protein Ris

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45626
Species: Hu
Applications: WB, IHC
MAB3429
Species: Hu
Applications: WB
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-87217
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60054
Species: Hu
Applications: WB
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-16463
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13229
Species: Hu
Applications: IHC, IHC-P
NBP1-60046
Species: Hu, Mu, Rt, Po, Bv, Eq, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83368
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83957
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IF
NBP1-89694
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000251-M07
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP, RNAi
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-98570
Species: Mu
Applications: WB

Publications for RASL12 Antibody (NBP1-98570) (0)

There are no publications for RASL12 Antibody (NBP1-98570).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASL12 Antibody (NBP1-98570) (0)

There are no reviews for RASL12 Antibody (NBP1-98570). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RASL12 Antibody (NBP1-98570) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RASL12 Antibody Products

Related Products by Gene

Bioinformatics Tool for RASL12 Antibody (NBP1-98570)

Discover related pathways, diseases and genes to RASL12 Antibody (NBP1-98570). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RASL12

There are no specific blogs for RASL12, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol RASL12
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-98570 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought