RASL12 Antibody - BSA Free

Western Blot: RASL12 Antibody [NBP1-98570] - Mouse Heart Lysate 1.0ug/ml, Gel Concentration: 12%

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RASL12 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is Rasl12 - N-terminal region. Peptide sequence DPNLEDTYSSEETVDHQPVHLRVMDTADLDTPRNCERYLNWAHAFLVVYS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RASL12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RASL12 Antibody - BSA Free

• Ras family member Ris
• ras-like protein family member 12
• RAS-like, family 12
• RISRas-like protein Ris

Background

Belonging to the small GTPase superfamily/Ras family, RASL12 is localized in the cellular membrane and cytoplasm. RASL12 has many important molecular functions including GTP binding, GTPase activity and nucleotide binding. The main biological function of this gene is to participate in the GTP catabolic process, signal transduction and small GTPase mediated signal transduction. RASL12 interacts with ACVR1, SMAD1, SMAD2, SMAD3 and SMURF2. Documented diseases associated with RASL12 include acute kidney tubular necrosis, intraepithelial neoplasm, retinitis, endometrial cancer, coronary artery disease and Huntington's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RASL12
• Uniprot:
  • NP_001028330(Mouse)