ALPPL2 Antibody (2B3)

Western Blot: ALPPL2 Antibody (2B3) [H00000251-M07] - Analysis of ALPPL2 expression in transfected 293T cell line by ALPPL2 monoclonal antibody (M07), clone 2B3. Lane 1: ALPPL2 transfected lysatE (57.5 KDa). Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: ALPPL2 Antibody (2B3) [H00000251-M07] - Analysis of monoclonal antibody to ALPPL2 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml

Western Blot: ALPPL2 Antibody (2B3) [H00000251-M07] - ALPPL2 over-expressed 293 cell line. Lane 2 cotransfected with ALPPL2 Validated Chimera RNAi Lane 1 non-transfected control. Blot probed with H00000251-M07. GAPDH (36.1 kDa) used as loading control.

Western Blot: ALPPL2 Antibody (2B3) [H00000251-M07] - Analysis of ALPPL2 expression in A-431 (Cat # L015V1).

Immunoprecipitation: ALPPL2 Antibody (2B3) [H00000251-M07] - Analysis of ALPPL2 transfected lysate using anti-ALPPL2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ALPPL2 rabbit polyclonal antibody.

Sandwich ELISA Capture: ALPPL2 Antibody (2B3) [H00000251-M07] - Detection limit for recombinant GST tagged ALPPL2 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC, IHC-P, IP, S-ELISA, ELISA(Cap), KD
• Clone: 2B3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

ALPPL2 Antibody (2B3) Summary

• Immunogen: ALPPL2 (NP_112603, 365 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE
• Specificity: ALPPL2 - alkaline phosphatase, placental-like 2
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ALPG
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation
  • Knockdown Validated
  • Sandwich ELISA Capture
  • Sandwich ELISA
  • Western Blot 1:100-1:2000
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ALPPL2 Antibody (2B3)

• Alkaline phosphatase Nagao isozyme
• alkaline phosphatase, placental-like 2
• alkaline phosphatase, placental-like
• ALP-1
• ALPG
• ALPPL
• EC 3.1.3.1
• GCAP
• Germ cell alkaline phosphatase
• Nagao isozyme
• Placental alkaline phosphatase-like
• placental-like alkaline phosphatase
• PLAP-like
• testicular and thymus alkaline phosphatase

Background

There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALPG
• Entrez:
  • 251(Human)
• OMIM:
  • 171810(Human)
• Uniprot:
  • NP_112603(Human)