ALPPL2 Antibody (2B3)

Images

 
Western Blot: ALPPL2 Antibody (2B3) [H00000251-M07] - Analysis of ALPPL2 expression in transfected 293T cell line by ALPPL2 monoclonal antibody (M07), clone 2B3. Lane 1: ALPPL2 transfected lysatE (57.5 KDa). Lane 2: ...read more
Immunohistochemistry-Paraffin: ALPPL2 Antibody (2B3) [H00000251-M07] - Analysis of monoclonal antibody to ALPPL2 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
Western Blot: ALPPL2 Antibody (2B3) [H00000251-M07] - ALPPL2 over-expressed 293 cell line. Lane 2 cotransfected with ALPPL2 Validated Chimera RNAi Lane 1 non-transfected control. Blot probed with H00000251-M07. GAPDH ...read more
Western Blot: ALPPL2 Antibody (2B3) [H00000251-M07] - Analysis of ALPPL2 expression in A-431 (Cat # L015V1).
Immunoprecipitation: ALPPL2 Antibody (2B3) [H00000251-M07] - Analysis of ALPPL2 transfected lysate using anti-ALPPL2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ALPPL2 rabbit polyclonal ...read more
Sandwich ELISA Capture: ALPPL2 Antibody (2B3) [H00000251-M07] - Detection limit for recombinant GST tagged ALPPL2 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IP, ELISA, KD
Clone
2B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ALPPL2 Antibody (2B3) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
ALPPL2 (NP_112603, 365 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDGETHAGE
Specificity
ALPPL2 - alkaline phosphatase, placental-like 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ALPG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation
  • Knockdown Validated
  • Sandwich ELISA Capture
  • Sandwich ELISA
  • Western Blot 1:100-1:2000
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ALPPL2 Antibody (2B3)

  • Alkaline phosphatase Nagao isozyme
  • alkaline phosphatase, placental-like 2
  • alkaline phosphatase, placental-like
  • ALP-1
  • ALPG
  • ALPPL
  • EC 3.1.3.1
  • GCAP
  • Germ cell alkaline phosphatase
  • Nagao isozyme
  • Placental alkaline phosphatase-like
  • placental-like alkaline phosphatase
  • PLAP-like
  • testicular and thymus alkaline phosphatase

Background

There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ALPPL2 Antibody (H00000251-M07) (0)

There are no publications for ALPPL2 Antibody (H00000251-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALPPL2 Antibody (H00000251-M07) (0)

There are no reviews for ALPPL2 Antibody (H00000251-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALPPL2 Antibody (H00000251-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALPPL2 Products

Research Areas for ALPPL2 Antibody (H00000251-M07)

Find related products by research area.

Blogs on ALPPL2

There are no specific blogs for ALPPL2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALPPL2 Antibody (2B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol ALPG
Entrez
OMIM
Uniprot