RHBDL1 Antibody

Western Blot: RHBDL1 Antibody [NBP2-57512] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunocytochemistry/Immunofluorescence: RHBDL1 Antibody [NBP2-57512] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RHBDL1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MGRVEDGGTTEELEDWDPGTSALPAPGIKQGPREQTGTGPLSQKCWEPEPDAPSQPGPALWSRGRARTQALAGGSSLQQLDPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RHBDL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RHBDL1 Recombinant Protein Antigen (NBP2-57512PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RHBDL1 Antibody

• EC 3.4.21.105
• RHBDLrhomboid, drosophila, homolog of
• rhomboid, veinlet-like 1 (Drosophila)
• Rhomboid-like protein 1
• rhomboid-related protein 1
• RRPrhomboid (veinlet, Drosophila)-like

Background

RHBDL1, also known as Rhomboid-related protein 1 is a 48kDa 438 amino acid protein with a shorter 41kDa 373 isoform produced by alternative splicing. It is believed to play a role in regulating intramembrane proteolysis. Current research on RHBDL1 is being conducted in relation to leber hereditary optic neuropathy and neuropathy. RHBDL1 is known to interact with ZWINT.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RHBDL1