RASGRP2 Antibody - BSA Free

Western Blot: RASGRP2 Antibody [NBP1-58871] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RASGRP2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RASGRP2(RAS guanyl releasing protein 2 (calcium and DAG-regulated)) The peptide sequence was selected from the N terminal of RASGRP2. Peptide sequence LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RASGRP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RASGRP2 Antibody - BSA Free

• Calcium and DAG-regulated guanine nucleotide exchange factor I
• CALDAG-GEFI
• CDC25Lcalcium and diacylglycerol-regulated guanine nucleotide exchange factor I
• Cdc25-like protein
• F25B3.3 kinase-like protein
• guanine exchange factor MCG7
• hCDC25L
• MCG7
• RAS guanyl nucleotide-releasing protein 2
• RAS guanyl releasing protein 2 (calcium and DAG-regulated)
• RAS guanyl-releasing protein 2

Background

The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can act

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RASGRP2
• Uniprot:
  • Q7LDG7(Human)