RASGRP2 Antibody

Images

 
Western Blot: RASGRP2 Antibody [NBP1-58871] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RASGRP2 Antibody Summary

Immunogen
Synthetic peptides corresponding to RASGRP2(RAS guanyl releasing protein 2 (calcium and DAG-regulated)) The peptide sequence was selected from the N terminal of RASGRP2. Peptide sequence LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASGRP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RASGRP2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RASGRP2 Antibody

  • Calcium and DAG-regulated guanine nucleotide exchange factor I
  • CALDAG-GEFI
  • CDC25Lcalcium and diacylglycerol-regulated guanine nucleotide exchange factor I
  • Cdc25-like protein
  • F25B3.3 kinase-like protein
  • guanine exchange factor MCG7
  • hCDC25L
  • MCG7
  • RAS guanyl nucleotide-releasing protein 2
  • RAS guanyl releasing protein 2 (calcium and DAG-regulated)
  • RAS guanyl-releasing protein 2

Background

The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can act

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22527
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-68636
Species: Hu
Applications: ICC/IF
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-78249
Species: Hu, Rt, Pm
Applications: WB, DB, ELISA, ICC/IF, IHC, IHC-P, IP
H00010411-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF1730
Species: Hu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45528
Species: Hu
Applications: WB, IHC
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45515
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IF
AF6868
Species: Hu
Applications: WB, IHC
NBP2-20072
Species: Hu
Applications: WB, IHC, IHC-P
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-58871
Species: Hu
Applications: WB

Publications for RASGRP2 Antibody (NBP1-58871) (0)

There are no publications for RASGRP2 Antibody (NBP1-58871).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASGRP2 Antibody (NBP1-58871) (0)

There are no reviews for RASGRP2 Antibody (NBP1-58871). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RASGRP2 Antibody (NBP1-58871) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RASGRP2 Antibody (NBP1-58871)

Discover related pathways, diseases and genes to RASGRP2 Antibody (NBP1-58871). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASGRP2 Antibody (NBP1-58871)

Discover more about diseases related to RASGRP2 Antibody (NBP1-58871).
 

Pathways for RASGRP2 Antibody (NBP1-58871)

View related products by pathway.

PTMs for RASGRP2 Antibody (NBP1-58871)

Learn more about PTMs related to RASGRP2 Antibody (NBP1-58871).

Blogs on RASGRP2

There are no specific blogs for RASGRP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASGRP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASGRP2
Uniprot