Ras-GAP Antibody

Images

 
Immunohistochemistry-Paraffin: Ras-GAP Antibody [NBP2-55354] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: Ras-GAP Antibody [NBP2-55354] - Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Ras-GAP Antibody [NBP2-55354] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Ras-GAP Antibody [NBP2-55354] - Staining in human placenta and pancreas tissues using anti-RASA1 antibody. Corresponding RASA1 RNA-seq data are presented for ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Ras-GAP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLSSHIPLKGIEPGSLRVRARYSMEKIMPEEEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISMEDEATT
Specificity
Specificity of human Ras-GAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASA1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Ras-GAP Recombinant Protein Antigen (NBP2-55354PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Ras-GAP Antibody

  • CM-AVM
  • PKWS
  • RASA1
  • RasGAP
  • Ras-GAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-49172
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45745
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IF
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-82112
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-14119
Species: Hu
Applications: IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-80507
Species: Hu
Applications: WB
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA

Publications for Ras-GAP Antibody (NBP2-55354) (0)

There are no publications for Ras-GAP Antibody (NBP2-55354).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ras-GAP Antibody (NBP2-55354) (0)

There are no reviews for Ras-GAP Antibody (NBP2-55354). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Ras-GAP Antibody (NBP2-55354) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Ras-GAP Products

Bioinformatics Tool for Ras-GAP Antibody (NBP2-55354)

Discover related pathways, diseases and genes to Ras-GAP Antibody (NBP2-55354). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ras-GAP Antibody (NBP2-55354)

Discover more about diseases related to Ras-GAP Antibody (NBP2-55354).
 

Pathways for Ras-GAP Antibody (NBP2-55354)

View related products by pathway.

PTMs for Ras-GAP Antibody (NBP2-55354)

Learn more about PTMs related to Ras-GAP Antibody (NBP2-55354).

Blogs on Ras-GAP

There are no specific blogs for Ras-GAP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ras-GAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASA1