RANBP9 Antibody

Images

 
Immunohistochemistry-Paraffin: RANBP9 Antibody [NBP2-47315] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts, Leydig cells exhibited strong cytoplasmic staining.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RANBP9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YPVSPRPFSSPSMSPSHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVP
Specificity
Specificity of human RANBP9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RANBP9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RANBP9 Antibody

  • BPM90
  • BPM-L
  • RAN binding protein 9
  • Ran Binding Protein in the Microtubule organizing center
  • ran binding protein, centrosomal
  • ran-binding protein 9
  • Ran-binding protein M
  • RanBP7
  • RanBP9
  • RanBPM
  • RANBPMnovel centrosomal protein RanBPM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61832
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-80655
Species: Hu
Applications: IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-77372
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-89727
Species: Hu
Applications: IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-80841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KO
7270-IL/CF
Species: Hu
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF276
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, ICC, KO
NBP2-76961
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
NBP1-82643
Species: Hu
Applications: WB, IHC, IHC-P
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, IF
NBP2-47315
Species: Hu, Rt
Applications: IHC, IHC-P

Publications for RANBP9 Antibody (NBP2-47315) (0)

There are no publications for RANBP9 Antibody (NBP2-47315).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RANBP9 Antibody (NBP2-47315) (0)

There are no reviews for RANBP9 Antibody (NBP2-47315). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RANBP9 Antibody (NBP2-47315) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RANBP9 Products

Bioinformatics Tool for RANBP9 Antibody (NBP2-47315)

Discover related pathways, diseases and genes to RANBP9 Antibody (NBP2-47315). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RANBP9 Antibody (NBP2-47315)

Discover more about diseases related to RANBP9 Antibody (NBP2-47315).
 

Pathways for RANBP9 Antibody (NBP2-47315)

View related products by pathway.

PTMs for RANBP9 Antibody (NBP2-47315)

Learn more about PTMs related to RANBP9 Antibody (NBP2-47315).

Blogs on RANBP9.

CD68 (Cluster of differentiation 68, GP110, LAMP4, SCARD1)
CD68 belongs to a growing family of hematopoietic mucin-like molecules known as lysosomal/endosomal-associated membrane glycoproteins (LAMPs). Other LAMP family members included leukosialin, stem cell antigen CD34, and GlyCAM-1. CD68 encodes a 110-kD...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RANBP9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RANBP9